Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46940 68 / 3e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G02250 60 / 2e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G02550 52 / 4e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G64620 50 / 1e-07 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1) AT2G47340 49 / 4e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G55770 49 / 4e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G36659 49 / 5e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46930 48 / 5e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46970 47 / 6e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17220 47 / 1e-06 ATPMEI2 pectin methylesterase inhibitor 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031483 [exp] 297 / 7e-104 AT5G46940 64 / 8e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10029877 [exp] 168 / 5e-53 AT5G64620 67 / 7e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10020664 [exp] 159 / 5e-50 AT5G64620 67 / 2e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10008201 [exp] 89 / 4e-22 AT4G02250 113 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10001464 [exp] 87 / 3e-21 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10019498 [exp] 55 / 3e-09 AT5G46970 87 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10003530 [exp] 50 / 1e-07 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10002933 [exp] 49 / 2e-07 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10043346 [exp] 46 / 2e-06 AT5G46940 69 / 3e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G134900 [exp] 82 / 2e-19 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.004G016500 [exp] 76 / 3e-17 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.002G191500 [exp] 72 / 7e-16 AT2G31430 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G044100 [exp] 71 / 3e-15 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023201 [exp] 70 / 2e-14 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023100 [exp] 70 / 3e-14 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023050 [exp] 69 / 5e-14 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G127500 [exp] 67 / 8e-14 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086600 [exp] 61 / 9e-12 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086500 [exp] 59 / 6e-11 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10015199 pacid=23149533 polypeptide=Lus10015199 locus=Lus10015199.g ID=Lus10015199.BGIv1.0 annot-version=v1.0 ATGAGTTTTCCTTCAATGATCTTCACACTTTGCCTCCTCTTCATCTACCAATCCAATGCTCAAGCTCCGGCTCCAGCTCCGGCTTACACAACAACAACAA CCACGACAACCGGTCCCACAATGTCGAAGCCGGAGCTACTAAACAAAGTATGCCATTGCAAATACAAGCCCCTGTGCATGGCCTTCCTCGGCTCCTTCCC GGAATCGGAGGTGAAGGACATGCACGGGCTGGCGAAATTCGCGCTCAAGATGGTGTCCCTGAATGTGACCAAGGTCCACGGGGACATTGAGAAGATGGAG GCTGCGTCCACGGACGATGTGGTGAAACAGAAGCTGAACGACTGTGGGGAGAATTACCAGGATGTCATTGATCAGTTCGAGGACGCGATGCCCGCGCTGG ACTCGAAGGCTTACGACGATGTGATCACGTTCATAACCGCGGCTATGAACGATGTCCAAGCTTGCGAGGACGGGTTCAAGCAGCCGCCCGTGGCTAAGTC TCCCCTCACTGTGACTAATGATGGTGTGACACAGTTGTGCAATGTTTGTTTGTCCATTGCTAACATGGTTGGCAAGTAG
AA sequence Show only first row Show all	>Lus10015199 pacid=23149533 polypeptide=Lus10015199 locus=Lus10015199.g ID=Lus10015199.BGIv1.0 annot-version=v1.0 MSFPSMIFTLCLLFIYQSNAQAPAPAPAYTTTTTTTTGPTMSKPELLNKVCHCKYKPLCMAFLGSFPESEVKDMHGLAKFALKMVSLNVTKVHGDIEKME AASTDDVVKQKLNDCGENYQDVIDQFEDAMPALDSKAYDDVITFITAAMNDVQACEDGFKQPPVAKSPLTVTNDGVTQLCNVCLSIANMVGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G46940			Plant invertase/pectin methyle...		Lus10015199 [exp]	0	1
AT2G37240			Thioredoxin superfamily protei...		Lus10029111 [exp]	3.7	0.8865
AT4G14368			Regulator of chromosome conden...		Lus10027273 [exp]	4.9	0.8674
AT2G12646			PLATZ transcription factor fam...		Lus10038103 [exp]	7.3	0.8178
AT5G51780	bHLH	bHLH036	basic helix-loop-helix (bHLH) ...		Lus10027394 [exp]	7.5	0.8694
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10022883 [exp]	10.4	0.8678
AT5G08350			GRAM domain-containing protein...		Lus10017373 [exp]	12.4	0.8354
AT5G51780	bHLH	bHLH036	basic helix-loop-helix (bHLH) ...		Lus10031676 [exp]	14.0	0.8646
AT2G42760			unknown protein		Lus10005429 [exp]	17.8	0.8546
AT5G47060			Protein of unknown function (D...		Lus10019494 [exp]	19.3	0.8268
					Lus10017966 [exp]	23.0	0.8272

Compare expression of checked genes

Lus10015199 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.