Lus10015214 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26990 156 / 4e-48 Drought-responsive family protein (.1)
AT3G05700 150 / 1e-45 Drought-responsive family protein (.1)
AT1G56280 130 / 3e-38 ATDI19 drought-induced 19 (.1.2)
AT3G06760 99 / 7e-26 Drought-responsive family protein (.1.2)
AT5G49230 82 / 3e-19 HRB1 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
AT1G02750 72 / 2e-15 Drought-responsive family protein (.1.2)
AT4G02200 55 / 2e-09 Drought-responsive family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031467 298 / 7e-104 AT5G26990 253 / 1e-85 Drought-responsive family protein (.1)
Lus10017097 95 / 2e-24 AT5G49230 131 / 2e-38 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Lus10010305 89 / 1e-21 AT3G06760 108 / 5e-29 Drought-responsive family protein (.1.2)
Lus10037819 88 / 2e-21 AT5G49230 198 / 3e-64 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Lus10037717 90 / 6e-21 AT4G16100 321 / 2e-103 Protein of unknown function (DUF789) (.1)
Lus10013420 82 / 5e-19 AT3G06760 124 / 3e-35 Drought-responsive family protein (.1.2)
Lus10001462 67 / 2e-13 AT3G05700 124 / 5e-35 Drought-responsive family protein (.1)
Lus10002441 63 / 6e-13 AT5G26990 95 / 3e-25 Drought-responsive family protein (.1)
Lus10015412 56 / 3e-09 AT5G26990 123 / 1e-34 Drought-responsive family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G011200 236 / 3e-79 AT3G05700 250 / 1e-84 Drought-responsive family protein (.1)
Potri.005G020900 225 / 4e-75 AT3G05700 224 / 3e-74 Drought-responsive family protein (.1)
Potri.010G000800 127 / 8e-37 AT5G49230 190 / 5e-61 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.008G213400 117 / 9e-33 AT5G49230 196 / 2e-63 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.014G125500 83 / 1e-19 AT3G05700 148 / 2e-44 Drought-responsive family protein (.1)
Potri.002G200500 77 / 2e-17 AT3G05700 152 / 7e-46 Drought-responsive family protein (.1)
Potri.011G057200 58 / 2e-10 AT3G06760 110 / 2e-29 Drought-responsive family protein (.1.2)
Potri.019G027300 56 / 2e-10 AT5G49230 123 / 1e-36 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.012G086500 52 / 2e-08 AT1G56280 92 / 6e-23 drought-induced 19 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0361 C2H2-zf PF05605 zf-Di19 Drought induced 19 protein (Di19), zinc-binding
Representative CDS sequence
>Lus10015214 pacid=23149512 polypeptide=Lus10015214 locus=Lus10015214.g ID=Lus10015214.BGIv1.0 annot-version=v1.0
ATGGATGGTGATTCGTGGAGCGCTCGTCTCTCTTCTGCTTCCAAGAGATACCAATCAGCTCTCCAATCCCGATCTGATATGTTCATGGGATTTGAAGAAA
TCGACGTTGATGATGATATGAGGGAGGAGTTCCCGTGCCCTTTCTGTTCGGACTACTTCGATATAGTCGGGTTGTGTTGTCACATAGATGATGAGCATCC
CGTGGAAGCGAAGAACGGGCGCAAGAGGAAATCGCGTAGAGGACATTCGAGCCTTTCCTTGTTGCGGAAAGAATTACGAGAAGGAAATCTGCAGTCCCTT
TTTGGGTCCTCGTGTATAGTTTCGTCTTCCTCTTCTTCAAACACTGCTCCCGACCCCTTGTTGTCGTCCTTCATCTTACCAATGGGAGACGATTTCGCCA
GTCCTCACCCCTCTTTCTCGACCGACACAAGTTCCACCAAGAAAGGAGGCGCCACGGCAGAGAGTGTTTCAGAAAGAAATACGACGAAGTCGCCTCCATT
GTCTGTCAAGGATAAGGAGGAGAAAGCGAGAAGGAGCGAGTTCGTTCAAGGGATGTTATTGTCCACCATTTTCGGCGATGTTTCATAA
AA sequence
>Lus10015214 pacid=23149512 polypeptide=Lus10015214 locus=Lus10015214.g ID=Lus10015214.BGIv1.0 annot-version=v1.0
MDGDSWSARLSSASKRYQSALQSRSDMFMGFEEIDVDDDMREEFPCPFCSDYFDIVGLCCHIDDEHPVEAKNGRKRKSRRGHSSLSLLRKELREGNLQSL
FGSSCIVSSSSSSNTAPDPLLSSFILPMGDDFASPHPSFSTDTSSTKKGGATAESVSERNTTKSPPLSVKDKEEKARRSEFVQGMLLSTIFGDVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26990 Drought-responsive family prot... Lus10015214 0 1
AT1G04760 ATVAMP726 vesicle-associated membrane pr... Lus10036203 1.0 0.8933
AT3G09085 Protein of unknown function (D... Lus10017182 2.2 0.8675
AT1G17370 UBP1B oligouridylate binding protein... Lus10011924 7.6 0.8779
AT2G45170 ATATG8E AUTOPHAGY 8E (.1.2) Lus10004352 8.7 0.8719
AT1G22040 Galactose oxidase/kelch repeat... Lus10020960 9.2 0.8708
Lus10007301 9.5 0.8528
AT2G38000 chaperone protein dnaJ-related... Lus10021120 10.6 0.7935
AT1G71340 AtGDPD4 glycerophosphodiester phosphod... Lus10013777 10.7 0.8465
AT2G21600 ATRER1B endoplasmatic reticulum retrie... Lus10041766 10.8 0.8546
AT3G07870 F-box and associated interacti... Lus10006403 13.7 0.8510

Lus10015214 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.