Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53400 199 / 1e-67 Ubiquitin domain-containing protein (.1) AT5G45740 182 / 4e-61 Ubiquitin domain-containing protein (.1) AT1G16960 164 / 6e-54 Ubiquitin domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029264 [exp] 211 / 3e-72 AT1G53400 192 / 6e-65 Ubiquitin domain-containing protein (.1) Lus10007315 [exp] 209 / 8e-72 AT1G53400 194 / 8e-66 Ubiquitin domain-containing protein (.1) Lus10005423 [exp] 194 / 1e-65 AT1G53400 165 / 2e-54 Ubiquitin domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G107700 [exp] 191 / 3e-64 AT1G53400 172 / 2e-56 Ubiquitin domain-containing protein (.1) Potri.001G387400 [exp] 177 / 7e-59 AT1G53400 182 / 4e-61 Ubiquitin domain-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015233 pacid=23178822 polypeptide=Lus10015233 locus=Lus10015233.g ID=Lus10015233.BGIv1.0 annot-version=v1.0 ATGGGTTGCGCGGGGTCTTCCATGGTCAAGGGAGATGGAGGTAATAAGAAGATAAGGAAGCCAAAGCCATGGAAACATTCCGAACCGATCACTAGGGCAC AGCTCGTGAAGATGCGCGACGAGTTCTGGGACACTGCTCCTCATTATGGCGGTCGGAAAGAGATATGGGATGCACTTCGTGTTGCTGCAGAAGCCGAAAT CAGTCTTGCACAGGCCATAGTGGACAGCGCCGGTGTAATCGTGCAGAGTGAGGACTTAACCATTTGCTACGACGAGAGAGGCGCAAAGTATGAACTTCCG AAGTATGTGCTGAGCGAGCCGTCCAATTTGGTTCAACCCGAGAAGTGA
AA sequence Show only first row Show all	>Lus10015233 pacid=23178822 polypeptide=Lus10015233 locus=Lus10015233.g ID=Lus10015233.BGIv1.0 annot-version=v1.0 MGCAGSSMVKGDGGNKKIRKPKPWKHSEPITRAQLVKMRDEFWDTAPHYGGRKEIWDALRVAAEAEISLAQAIVDSAGVIVQSEDLTICYDERGAKYELP KYVLSEPSNLVQPEK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G53400			Ubiquitin domain-containing pr...		Lus10015233 [exp]	0	1
AT4G27650		PEL1	PELOTA, Eukaryotic release fac...		Lus10009553 [exp]	9.9	0.8189
AT1G70160			unknown protein		Lus10029209 [exp]	13.0	0.8386
AT2G37480			unknown protein		Lus10024420 [exp]	13.5	0.8324
AT1G01200		ATRAB-A3, AtRAB...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10030221 [exp]	15.9	0.7988
AT2G48150		ATGPX4	glutathione peroxidase 4 (.1)		Lus10029651 [exp]	18.0	0.8004
AT3G27010	TCP	ATTCP20, PCF1, ...	ARABIDOPSIS THALIANA TEOSINTE ...		Lus10035193 [exp]	18.0	0.8186
AT1G80245			Spc97 / Spc98 family of spindl...		Lus10042425 [exp]	20.9	0.7301
AT5G19140		AtAILP1, AILP1	Aluminium induced protein with...		Lus10010505 [exp]	22.1	0.8334
AT1G60940		SNRK2-10, SNRK2...	SNF1-RELATED KINASE 2B, SUCROS...		Lus10001367 [exp]	26.3	0.8276
AT1G79660			unknown protein		Lus10024088 [exp]	28.6	0.8157

Compare expression of checked genes

Lus10015233 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.