Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015249 pacid=23178794 polypeptide=Lus10015249 locus=Lus10015249.g ID=Lus10015249.BGIv1.0 annot-version=v1.0 ATGGAGAATGAGAATACGCTCATGGAGCTGCTAGTGGCGGAATCTAACCTCAGTTTAGGCCGTCCGGACAAAGTCCTCAAACGCACCACCATGAGAGTCC TTGGTTTTGGAGGAATGTTGTTGGCTGAAGCGGTTGTTTACCACGCCCCCATACTCACCGTCCAGATTCCTCTGCTCTGGATTAGCTATGGCGCCGGAGA CCTGACCGACCTCGTGCCGGAGCTTTTTGAAGAGCTCTGGTTCAATCATCTCTGTGCTCTTGCGGCGGCGATGCTCAACGACTAG
AA sequence Show only first row Show all	>Lus10015249 pacid=23178794 polypeptide=Lus10015249 locus=Lus10015249.g ID=Lus10015249.BGIv1.0 annot-version=v1.0 MENENTLMELLVAESNLSLGRPDKVLKRTTMRVLGFGGMLLAEAVVYHAPILTVQIPLLWISYGAGDLTDLVPELFEELWFNHLCALAAAMLND

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10015249 [exp]	0	1
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10004347 [exp]	1.0	0.9234
					Lus10037199 [exp]	2.4	0.8164
AT5G45820		PKS18, CIPK20, ...	SNF1-RELATED PROTEIN KINASE 3....		Lus10007283 [exp]	3.5	0.7873
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Lus10030286 [exp]	9.4	0.7644
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10021338 [exp]	10.5	0.7644
AT3G51770		ATEOL1, ETO1	ARABIDOPSIS ETHYLENE OVERPRODU...		Lus10010040 [exp]	11.3	0.7217
AT1G27220			paired amphipathic helix repea...		Lus10000805 [exp]	11.5	0.7644
AT3G07820			Pectin lyase-like superfamily ...		Lus10013783 [exp]	12.3	0.5608
					Lus10033096 [exp]	12.4	0.7644
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10010229 [exp]	13.3	0.7570

Compare expression of checked genes

Lus10015249 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.