Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40690 79 / 5e-19 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025381 [exp] 157 / 1e-50 AT5G40690 81 / 3e-20 unknown protein Lus10003797 [exp] 122 / 2e-36 AT5G40690 128 / 2e-37 unknown protein Lus10010488 [exp] 121 / 7e-36 AT5G40690 136 / 1e-40 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G336200 [exp] 77 / 2e-18 AT5G40690 147 / 2e-44 unknown protein Potri.001G338100 [exp] 69 / 6e-16 AT5G40690 137 / 7e-42 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015261 pacid=23178712 polypeptide=Lus10015261 locus=Lus10015261.g ID=Lus10015261.BGIv1.0 annot-version=v1.0 ATGGCGAGGAGTGGACGCAAACATGGCGTGGTAAGAACGTTCACCACTACGGTCGGTGGTGACGAGTCCCCACCGCCCACGTCCTCCAAGTTCACGGGGA AATGCGGGGTCCCGCGATGCAAGGAGTGGCACATCCACCCGTGTACCAAGTCCAAGGACAAGGCTAAAGGGACCCAGAAGTTCCGGTCGAACGATGTCAC GTCCAATCATAGATTGGTTTTGTGGGCGGTTGTGGGCGGTGGCTGCCTGTTGAGATCTAATGGGTTTTCGGCCACCGGAGTATTGGATCGGTTAGTGAGT GTAGATAGATATTTCAATGCTGATGAAGCTCGTCGAGAGATCAACGACGATGATGACGAAATTGAGGATCACATATGA
AA sequence Show only first row Show all	>Lus10015261 pacid=23178712 polypeptide=Lus10015261 locus=Lus10015261.g ID=Lus10015261.BGIv1.0 annot-version=v1.0 MARSGRKHGVVRTFTTTVGGDESPPPTSSKFTGKCGVPRCKEWHIHPCTKSKDKAKGTQKFRSNDVTSNHRLVLWAVVGGGCLLRSNGFSATGVLDRLVS VDRYFNADEARREINDDDDEIEDHI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G40690			unknown protein		Lus10015261 [exp]	0	1
AT5G57510			unknown protein		Lus10033559 [exp]	7.4	0.9398
AT3G15980			Coatomer, beta' subunit (.1.2....		Lus10026094 [exp]	13.3	0.9344
AT1G14550			Peroxidase superfamily protein...		Lus10024208 [exp]	13.7	0.9379
AT5G39130			RmlC-like cupins superfamily p...		Lus10000622 [exp]	16.9	0.9215
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10006119 [exp]	20.4	0.9090
AT5G06500	MADS	AGL96	AGAMOUS-like 96 (.1)		Lus10029367 [exp]	26.2	0.9159
AT4G37470			alpha/beta-Hydrolases superfam...		Lus10015633 [exp]	26.5	0.8870
AT3G26210		CYP71B23	"cytochrome P450, family 71, s...		Lus10030708 [exp]	28.1	0.9281
AT5G44440			FAD-binding Berberine family p...		Lus10012641 [exp]	30.2	0.9209
AT5G46030			unknown protein		Lus10014995 [exp]	32.2	0.8712

Compare expression of checked genes

Lus10015261 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.