Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G60970 55 / 3e-11 SNARE-like superfamily protein (.1) AT4G08520 50 / 3e-09 SNARE-like superfamily protein (.1) AT3G09800 47 / 4e-08 SNARE-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025383 [exp] 79 / 3e-20 AT1G60970 235 / 6e-80 SNARE-like superfamily protein (.1) Lus10037624 [exp] 55 / 4e-11 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1) Lus10006883 [exp] 55 / 4e-11 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G043200 [exp] 57 / 4e-12 AT1G60970 288 / 4e-101 SNARE-like superfamily protein (.1) Potri.001G197200 [exp] 57 / 7e-12 AT3G09800 287 / 1e-100 SNARE-like superfamily protein (.1) Potri.001G352900 [exp] 44 / 3e-07 AT1G60970 278 / 6e-97 SNARE-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015263 pacid=23178767 polypeptide=Lus10015263 locus=Lus10015263.g ID=Lus10015263.BGIv1.0 annot-version=v1.0 ATGGCGGGTAACGTGAACGATGATCCCTCTGGAAACGATGCAACTGTTCTTGCAAGCAAGGTTGCTACCTACAATATTGAACCAGTCGCTCCATTGTCGG AGCAGACATTGGCTCAAGCTCTGGTCATGGCACGGGAACATCTCACCAGATCCCTTCTTAAGTGA
AA sequence Show only first row Show all	>Lus10015263 pacid=23178767 polypeptide=Lus10015263 locus=Lus10015263.g ID=Lus10015263.BGIv1.0 annot-version=v1.0 MAGNVNDDPSGNDATVLASKVATYNIEPVAPLSEQTLAQALVMAREHLTRSLLK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G60970			SNARE-like superfamily protein...		Lus10015263 [exp]	0	1
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10042693 [exp]	20.7	0.5723
					Lus10014735 [exp]	31.2	0.5135
AT3G27250			unknown protein		Lus10014610 [exp]	53.5	0.5651
					Lus10004635 [exp]	86.7	0.5085
AT5G56170		LLG1	LORELEI-LIKE-GPI-ANCHORED PROT...		Lus10000405 [exp]	119.5	0.4945
AT1G20960		EMB1507	embryo defective 1507, U5 smal...		Lus10042629 [exp]	132.9	0.4824
AT4G10120		ATSPS4F	Sucrose-phosphate synthase fam...		Lus10006185 [exp]	150.9	0.4437

Compare expression of checked genes

Lus10015263 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.