Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06475 44 / 1e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025392 [exp] 180 / 5e-60 AT1G06475 59 / 1e-12 unknown protein Lus10004931 [exp] 82 / 2e-21 AT1G06475 47 / 7e-08 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G131200 [exp] 71 / 3e-17 AT5G46295 / unknown protein Potri.011G079900 [exp] 61 / 3e-13 AT5G46295 57 / 3e-12 unknown protein Potri.005G203800 [exp] 53 / 1e-10 AT1G06475 64 / 5e-15 unknown protein Potri.002G058400 [exp] 44 / 7e-07 AT1G06475 64 / 5e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015269 pacid=23178800 polypeptide=Lus10015269 locus=Lus10015269.g ID=Lus10015269.BGIv1.0 annot-version=v1.0 ATGAGGAGCAACGATGCTACCTTGGACGGAGAAGAAGAAATCAGACCGGCAGCAAGCATGAGTCCGCCGTGCGTCGCCGCCGCCACCGGCGACAGCGAGA GTAGGAAGAAGCAGAAGAAGAGATCAGGATCGTGGGTTCTAAAGAGAATGATCATGAAAGTGAACAAAGATTCGCTTAGATGGAGGTGGAAGTACTTGAC GTCTGCTTTCAAATGGAAGCGAGTGGAATATCTTCAGATTTCGCTCGTCGACGATGTCCTCTTCAAGGTCGTTTCGGCTCTGGAAGCCGTCGTTTTGGTC GCCACCGTTTCCTTCTTCTACCTCTGCTGCGGCTGCCACTTTTGA
AA sequence Show only first row Show all	>Lus10015269 pacid=23178800 polypeptide=Lus10015269 locus=Lus10015269.g ID=Lus10015269.BGIv1.0 annot-version=v1.0 MRSNDATLDGEEEIRPAASMSPPCVAAATGDSESRKKQKKRSGSWVLKRMIMKVNKDSLRWRWKYLTSAFKWKRVEYLQISLVDDVLFKVVSALEAVVLV ATVSFFYLCCGCHF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G06475			unknown protein		Lus10015269 [exp]	0	1
AT5G05260		CYP79A2	cytochrome p450 79a2 (.1)		Lus10000627 [exp]	2.0	0.8958
AT5G23040		CDF1	CELL GROWTH DEFECT FACTOR 1, P...		Lus10000868 [exp]	3.9	0.8709
AT2G26690			Major facilitator superfamily ...		Lus10018553 [exp]	4.5	0.8864
AT2G26690			Major facilitator superfamily ...		Lus10039782 [exp]	6.6	0.8711
AT3G13130			unknown protein		Lus10039066 [exp]	6.9	0.8683
AT3G51790		ATG1	transmembrane protein G1P-rela...		Lus10031266 [exp]	7.0	0.8656
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10023144 [exp]	7.7	0.8609
AT1G75620			glyoxal oxidase-related protei...		Lus10024312 [exp]	8.3	0.8736
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Lus10035053 [exp]	8.5	0.8218
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Lus10023140 [exp]	9.2	0.8331

Compare expression of checked genes

Lus10015269 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.