Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59310 110 / 1e-32 LTP4 lipid transfer protein 4 (.1) AT5G59320 104 / 2e-30 LTP3 lipid transfer protein 3 (.1) AT4G33355 89 / 4e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G51590 88 / 1e-23 LTP12 lipid transfer protein 12 (.1) AT2G38540 87 / 3e-23 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT2G38530 85 / 2e-22 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT3G51600 74 / 3e-18 LTP5 lipid transfer protein 5 (.1) AT2G15050 73 / 5e-18 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT3G08770 73 / 5e-18 LTP6 lipid transfer protein 6 (.1.2) AT5G01870 69 / 4e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015279 [exp] 147 / 2e-47 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10007280 [exp] 114 / 3e-34 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1) Lus10029226 [exp] 114 / 5e-34 AT5G59310 94 / 3e-26 lipid transfer protein 4 (.1) Lus10025234 [exp] 103 / 5e-30 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10014167 [exp] 96 / 1e-26 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10026418 [exp] 95 / 1e-26 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10022745 [exp] 94 / 3e-26 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10025231 [exp] 88 / 1e-23 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1) Lus10025401 [exp] 88 / 5e-23 AT4G25650 100 / 1e-24 TRANSLOCON AT THE INNER ENVELOPE MEMBRANE OF CHLOROPLASTS, 55 KDA - IV, PROTOCHLOROPHYLLIDE-DEPENDENT TRANSLOCON COMPONENT, 52 KDA, ACD1-like (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086500 [exp] 110 / 7e-33 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086600 [exp] 108 / 5e-32 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135400 [exp] 91 / 4e-25 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.006G108100 [exp] 90 / 1e-24 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G136000 [exp] 89 / 4e-24 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 86 / 7e-23 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135500 [exp] 77 / 2e-19 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.014G046500 [exp] 77 / 3e-19 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G232900 [exp] 75 / 1e-18 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232700 [exp] 72 / 1e-17 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10015278 pacid=23178809 polypeptide=Lus10015278 locus=Lus10015278.g ID=Lus10015278.BGIv1.0 annot-version=v1.0 ATGGTGGCGATGCTTGCCGCGTCACAGATTGCTGATGGGGCAATCACTTGCGGCAGAGTGGCATCCGGGATTGCACCGTGCTTGGGTTACATTAGGGGCA TGGCCCCACTCACGCCAGCCTGCTGTGGCGGGATCAAGTCGCTTAACGCCGCCGCCAGCTCCACCGTAGACAGGCAAGCGGCATGTCGTTGCCTTAAATC CGCTGCTAGTGGTGTCCGGGGTATCAACTACGGACTTGCTGGCGGCCTTCCCGGGAAGTGCGGAGTCAATGTCGGATTCCCCATCAGCCAATCCGTCAAC TGTGCCATGGTGAAGTGA
AA sequence Show only first row Show all	>Lus10015278 pacid=23178809 polypeptide=Lus10015278 locus=Lus10015278.g ID=Lus10015278.BGIv1.0 annot-version=v1.0 MVAMLAASQIADGAITCGRVASGIAPCLGYIRGMAPLTPACCGGIKSLNAAASSTVDRQAACRCLKSAASGVRGINYGLAGGLPGKCGVNVGFPISQSVN CAMVK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10015278 [exp]	0	1
AT1G30260		AGL79	unknown protein		Lus10038517 [exp]	2.8	0.8909
AT2G23180		CYP96A1	"cytochrome P450, family 96, s...		Lus10025677 [exp]	4.8	0.8958
AT4G39490		CYP96A10	"cytochrome P450, family 96, s...		Lus10018162 [exp]	6.7	0.8953
AT1G42550		PMI1	plastid movement impaired1 (.1...		Lus10039886 [exp]	7.6	0.8957
AT1G42550		PMI1	plastid movement impaired1 (.1...		Lus10002170 [exp]	9.8	0.8807
AT4G25570		ACYB-2	Cytochrome b561/ferric reducta...		Lus10027461 [exp]	10.9	0.8812
AT5G06530		AtABCG22, ABCG2...	Arabidopsis thaliana ATP-bindi...		Lus10015993 [exp]	12.7	0.8634
AT1G32080		AtLrgB	membrane protein, putative (.1...		Lus10010412 [exp]	20.7	0.8902
AT5G38420			Ribulose bisphosphate carboxyl...		Lus10009172 [exp]	27.2	0.8800
AT3G54050		HCEF1	high cyclic electron flow 1 (....		Lus10021115 [exp]	28.8	0.8838

Compare expression of checked genes

Lus10015278 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.