Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59320 116 / 5e-35 LTP3 lipid transfer protein 3 (.1) AT5G59310 105 / 1e-30 LTP4 lipid transfer protein 4 (.1) AT4G33355 98 / 1e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G38540 94 / 7e-26 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT3G51600 92 / 5e-25 LTP5 lipid transfer protein 5 (.1) AT3G51590 90 / 2e-24 LTP12 lipid transfer protein 12 (.1) AT2G38530 87 / 4e-23 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT5G01870 84 / 6e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G08770 79 / 6e-20 LTP6 lipid transfer protein 6 (.1.2) AT2G15050 77 / 2e-19 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015278 [exp] 147 / 4e-47 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1) Lus10025402 [exp] 115 / 2e-34 ND 66 / 1e-14 Lus10029226 [exp] 110 / 1e-32 AT5G59310 94 / 3e-26 lipid transfer protein 4 (.1) Lus10014167 [exp] 106 / 1e-30 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10022745 [exp] 104 / 4e-30 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10007280 [exp] 103 / 1e-29 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1) Lus10026418 [exp] 99 / 8e-28 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10025151 [exp] 96 / 9e-27 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10042210 [exp] 93 / 2e-25 AT5G59320 86 / 6e-23 lipid transfer protein 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086600 [exp] 124 / 4e-38 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086500 [exp] 123 / 1e-37 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135400 [exp] 100 / 2e-28 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.006G108100 [exp] 100 / 3e-28 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G136000 [exp] 98 / 1e-27 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 95 / 3e-26 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G046500 [exp] 78 / 9e-20 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.016G135500 [exp] 76 / 8e-19 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.001G232900 [exp] 75 / 2e-18 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232700 [exp] 75 / 2e-18 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10015279 pacid=23178715 polypeptide=Lus10015279 locus=Lus10015279.g ID=Lus10015279.BGIv1.0 annot-version=v1.0 ATGGCAGCTACCAAGTTGCAGATTTGCATGGCATTGATTGTGGTGATGGTGGCCACTTCCCACCTCGCCGAGGGGGCGGTGAGTTGTGGAAAGGTGGCGT CCGCACTGGCGCCCTGCGTCCCCTACCTCAGGGGTGTTGGAGCAGTGACGCCTGCCTGTTGCGGCGGGGTCAAGTCCCTTAACGCCGCCGCCACCACCAC CCCAGACAGGCAGGCGGCGTGCCGCTGCTTGAAATCCACTTCCGCCGGTATCTCCGGTATCAACTACGGCAACGCTGGCAGCCTTCCTGGGAAGTGCGGC GTCAACGTTGGCTACCCAATCAGCCCCACCGTCAATTGCAACACGTGA
AA sequence Show only first row Show all	>Lus10015279 pacid=23178715 polypeptide=Lus10015279 locus=Lus10015279.g ID=Lus10015279.BGIv1.0 annot-version=v1.0 MAATKLQICMALIVVMVATSHLAEGAVSCGKVASALAPCVPYLRGVGAVTPACCGGVKSLNAAATTTPDRQAACRCLKSTSAGISGINYGNAGSLPGKCG VNVGYPISPTVNCNT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10015279 [exp]	0	1
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10007674 [exp]	2.6	0.9536
AT3G54200			Late embryogenesis abundant (L...		Lus10035612 [exp]	2.6	0.9232
AT4G12300		CYP706A4	"cytochrome P450, family 706, ...		Lus10032216 [exp]	6.3	0.9185
AT5G18470			Curculin-like (mannose-binding...		Lus10003099 [exp]	6.5	0.9331
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10006244 [exp]	8.3	0.9265
AT5G52020	AP2_ERF		Integrase-type DNA-binding sup...		Lus10031652 [exp]	9.3	0.8298
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10022114 [exp]	10.8	0.9261
AT3G59010		PME61, PME35	pectin methylesterase 61 (.1)		Lus10026729 [exp]	10.8	0.8647
AT3G59010		PME61, PME35	pectin methylesterase 61 (.1)		Lus10025510 [exp]	11.2	0.9246
AT1G09080		BIP3	binding protein 3, Heat shock ...		Lus10013055 [exp]	12.0	0.9247

Compare expression of checked genes

Lus10015279 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.