Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G58630 137 / 4e-40 Trihelix sequence-specific DNA binding transcription factors (.1) AT3G14180 130 / 1e-36 Trihelix ASIL2 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) AT5G05550 119 / 1e-33 Trihelix sequence-specific DNA binding transcription factors (.1.2) AT3G11100 112 / 4e-31 Trihelix sequence-specific DNA binding transcription factors (.1) AT1G54060 99 / 7e-25 Trihelix ASIL1 6B-interacting protein 1-like 1 (.1) AT3G10030 80 / 7e-18 Trihelix aspartate/glutamate/uridylate kinase family protein (.1.2) AT3G24490 74 / 3e-16 Trihelix Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) AT3G54390 72 / 1e-15 Trihelix sequence-specific DNA binding transcription factors (.1) AT2G44730 67 / 2e-13 Trihelix Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) AT3G24860 57 / 5e-10 Trihelix Homeodomain-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025406 [exp] 236 / 3e-79 AT3G14180 202 / 3e-63 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10025404 [exp] 232 / 1e-77 AT3G14180 197 / 1e-61 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10007273 [exp] 198 / 1e-63 AT3G14180 200 / 4e-62 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10020652 [exp] 104 / 3e-26 AT5G16860 344 / 2e-106 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013179 [exp] 98 / 1e-24 AT3G14180 256 / 5e-81 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10008141 [exp] 97 / 5e-24 AT3G14180 271 / 3e-87 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10028984 [exp] 77 / 1e-18 AT3G14180 86 / 7e-21 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10024143 [exp] 73 / 2e-15 AT3G54390 172 / 2e-50 sequence-specific DNA binding transcription factors (.1) Lus10000963 [exp] 73 / 2e-15 AT2G44730 124 / 7e-32 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G118600 [exp] 196 / 2e-63 AT3G58630 139 / 5e-39 sequence-specific DNA binding transcription factors (.1) Potri.001G113600 [exp] 192 / 2e-61 AT3G58630 138 / 1e-38 sequence-specific DNA binding transcription factors (.1) Potri.001G026000 [exp] 111 / 7e-30 AT3G14180 186 / 1e-54 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Potri.T126206 [exp] 109 / 6e-29 AT3G14180 173 / 9e-50 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Potri.008G071300 [exp] 107 / 1e-28 AT5G05550 209 / 3e-67 sequence-specific DNA binding transcription factors (.1.2) Potri.003G200000 [exp] 107 / 2e-28 AT3G14180 172 / 2e-49 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Potri.001G028400 [exp] 82 / 5e-19 AT3G54390 297 / 6e-100 sequence-specific DNA binding transcription factors (.1) Potri.001G179800 [exp] 82 / 9e-19 AT3G24490 206 / 2e-63 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Potri.008G027000 [exp] 82 / 1e-18 AT3G10030 457 / 2e-157 aspartate/glutamate/uridylate kinase family protein (.1.2) Potri.010G233500 [exp] 77 / 4e-17 AT3G10030 434 / 3e-148 aspartate/glutamate/uridylate kinase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [flax] [poplar] HTH PF10545 [flax] [poplar] MADF_DNA_bdg Alcohol dehydrogenase transcription factor Myb/SANT-like
Representative CDS sequence Show only first row Show all	>Lus10015282 pacid=23178770 polypeptide=Lus10015282 locus=Lus10015282.g ID=Lus10015282.BGIv1.0 annot-version=v1.0 ATGGGCGACCTCACCGATTCCGGCACCACCCCAAATCCCAACCCTAATTCATCCTCAACCTCACGGCCGATGCCAATCCGGGAAGACTGCTGGAGCGAGG AAGCCACGGCGACGTTAGTCGAAGCCTGGGGGTACCGCTACCTCGCGCTCAACCGCGGCAACCTCCGCCAGAAGGACTGGAAAGACGTCGCCGATACGGT CAATTCCATCCACGGCCTCACCAAAAAGACATACCGCACCGATGTCCAGTGTAAGAATCGCGTCGATACCATCAAGAAGAAGTACAAGGTCGAGAAAACC CGCGTCGCCGCCTCCAACGGTGCCATAACCTCCTCCTGGCGATTTTTTGACCGATTGGATTCCCTCGTCGGATCCAATTTCTCCGGCGCTGCCGGCTCCG TTTCGGATGAACACCACCAGCGGCGGGCGTCGCCGCCCTCTCTGGGGAATCTCTCTCGCCTTCGCCTCCGGTTGCGCTGCCGTTGA
AA sequence Show only first row Show all	>Lus10015282 pacid=23178770 polypeptide=Lus10015282 locus=Lus10015282.g ID=Lus10015282.BGIv1.0 annot-version=v1.0 MGDLTDSGTTPNPNPNSSSTSRPMPIREDCWSEEATATLVEAWGYRYLALNRGNLRQKDWKDVADTVNSIHGLTKKTYRTDVQCKNRVDTIKKKYKVEKT RVAASNGAITSSWRFFDRLDSLVGSNFSGAAGSVSDEHHQRRASPPSLGNLSRLRLRLRCR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G58630	Trihelix		sequence-specific DNA binding ...		Lus10015282 [exp]	0	1
AT3G58630	Trihelix		sequence-specific DNA binding ...		Lus10015281 [exp]	1.4	0.8451
AT4G28440			Nucleic acid-binding, OB-fold-...		Lus10013989 [exp]	12.3	0.7652
AT1G33520		MOS2	modifier of snc1, 2, D111/G-pa...		Lus10004541 [exp]	15.7	0.7318
AT2G15980			Tetratricopeptide repeat (TPR)...		Lus10020712 [exp]	15.7	0.7297
AT5G62200			Embryo-specific protein 3, (AT...		Lus10031684 [exp]	16.0	0.7399
AT1G19800		ABCI14, TGD1	ATP-binding cassette I14, trig...		Lus10002636 [exp]	19.1	0.7509
AT3G24490	Trihelix		Alcohol dehydrogenase transcri...		Lus10017725 [exp]	19.4	0.7572
AT3G10400		U11/U12-31K	U11/U12-31K, RNA recognition m...		Lus10038693 [exp]	23.4	0.7294
AT5G49060			Heat shock protein DnaJ, N-ter...		Lus10006515 [exp]	23.5	0.7374
AT3G14180	Trihelix	ASIL2	Arabidopsis 6B-interacting pr...		Lus10025404 [exp]	23.6	0.7073

Compare expression of checked genes

Lus10015282 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.