Lus10015297 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G60860 428 / 6e-155 AtRABA1f RAB GTPase homolog A1F (.1)
AT3G15060 410 / 6e-148 AtRABA1g RAB GTPase homolog A1G (.1)
AT1G28550 393 / 3e-141 AtRABA1i RAB GTPase homolog A1I (.1)
AT2G33870 388 / 4e-139 ArRABA1h RAB GTPase homolog A1H (.1)
AT4G18430 387 / 1e-138 AtRABA1e RAB GTPase homolog A1E (.1)
AT4G18800 359 / 1e-127 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1)
AT5G45750 351 / 1e-124 AtRABA1c RAB GTPase homolog A1C (.1)
AT1G16920 342 / 6e-121 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1)
AT1G06400 337 / 5e-119 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
AT1G09630 314 / 4e-110 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025432 434 / 2e-157 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1)
Lus10002178 422 / 7e-153 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1)
Lus10017679 422 / 1e-152 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1)
Lus10013961 422 / 1e-152 AT5G60860 412 / 7e-149 RAB GTPase homolog A1F (.1)
Lus10039895 396 / 2e-142 AT5G60860 397 / 5e-143 RAB GTPase homolog A1F (.1)
Lus10029253 357 / 1e-126 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1)
Lus10007306 353 / 2e-125 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1)
Lus10020746 325 / 2e-114 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
Lus10029789 325 / 3e-114 AT1G06400 373 / 3e-133 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G123600 416 / 2e-150 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.019G092500 416 / 3e-150 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.011G061300 411 / 2e-148 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1)
Potri.001G374000 408 / 4e-147 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1)
Potri.011G070300 358 / 3e-127 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1)
Potri.004G061000 355 / 2e-126 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1)
Potri.003G004100 317 / 3e-111 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Potri.008G061300 304 / 6e-106 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.006G000300 301 / 4e-105 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.010G197200 301 / 7e-105 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00071 Ras Ras family
Representative CDS sequence
>Lus10015297 pacid=23178748 polypeptide=Lus10015297 locus=Lus10015297.g ID=Lus10015297.BGIv1.0 annot-version=v1.0
ATGGCGTACAGAGCGGACGACGATTACGACTACTTGTTCAAGGTGGTGTTGATCGGCGACTCCGGCGTCGGAAAGTCAAACCTCCTGTCGCGTTTCACAA
GGAACGAGTTCAGCCTCGAATCCAAATCCACGATCGGCGTCGAGTTCGCCACCAGGAGCATCCACGTCGACGACAAGGTCGTCAAGGCTCAGATTTGGGA
CACCGCCGGCCAGGAAAGGTACCGAGCAATAACGAGTGCATACTACCGAGGAGCGGTGGGGGCACTCCTGGTATACGATGTGACCCGTCACGTCACGTTC
GAGAACGTAGAGAGGTGGCTAAAGGAGCTCCGGGACCACACTGACGCCAACATCGTGATCATGCTTGTCGGGAACAAGGTTGATCTCCGCCACCTGCGGG
CGGTCTCGACCGAGGACTCCAAGTCATTCGCCGAAAGGGAGAACACCTTCTTCATGGAGACGTCCGCTCTCGAGTCCATGAACGTCGAGAATGCGTTCAC
GGAGGTGCTCACCCAGATCTACCGAGTCGTCAGCAGGAAGGCTCTCGACATCGGGGACGACCCTGCGGCCTTGCCGAGAGGGCAGACTATCAATGTCGGT
GGTAAAGATGACGTGTCTGCTGTGAAGAAAGTTGGTTGCTGCTCTTCTTAG
AA sequence
>Lus10015297 pacid=23178748 polypeptide=Lus10015297 locus=Lus10015297.g ID=Lus10015297.BGIv1.0 annot-version=v1.0
MAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTF
ENVERWLKELRDHTDANIVIMLVGNKVDLRHLRAVSTEDSKSFAERENTFFMETSALESMNVENAFTEVLTQIYRVVSRKALDIGDDPAALPRGQTINVG
GKDDVSAVKKVGCCSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G60860 AtRABA1f RAB GTPase homolog A1F (.1) Lus10015297 0 1
AT3G11820 PEN1, AT-SYR1, ... PENETRATION1, SYNTAXIN RELATED... Lus10029373 14.3 0.8051
AT5G44080 bZIP Basic-leucine zipper (bZIP) tr... Lus10028575 29.7 0.8127
AT5G20050 Protein kinase superfamily pro... Lus10013659 32.0 0.7654
AT1G54320 LEM3 (ligand-effect modulator ... Lus10001834 34.1 0.8107
AT5G39950 ATTRXH2, ATTRX2... Arabidopsis thioredoxin h2, th... Lus10005258 35.1 0.7988
AT3G09830 Protein kinase superfamily pro... Lus10026524 40.6 0.7977
AT2G20410 RNA-binding ASCH domain protei... Lus10006580 45.9 0.8058
AT1G15080 ATLPP2, LPP2, A... PHOSPHATIDIC ACID PHOSPHATASE ... Lus10034629 46.2 0.7781
AT4G32340 Tetratricopeptide repeat (TPR)... Lus10002914 82.5 0.7550
AT3G48340 CEP2 cysteine endopeptidase 2, Cyst... Lus10033631 90.8 0.7957

Lus10015297 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.