Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73165 44 / 3e-07 CLE1 CLAVATA3/ESR-RELATED 1 (.1) AT2G31085 40 / 6e-06 AtCLE6, CLE6 CLAVATA3/ESR-RELATED 6 (.1) AT2G31081 35 / 0.0005 CLE4 CLAVATA3/ESR-RELATED 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025422 [exp] 105 / 2e-31 ND 37 / 1e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G063700 [exp] 61 / 4e-14 AT1G73165 45 / 4e-08 CLAVATA3/ESR-RELATED 1 (.1) Potri.004G053700 [exp] 60 / 7e-14 AT1G06225 38 / 3e-05 CLAVATA3/ESR-RELATED 3 (.1) Potri.013G119100 [exp] 45 / 5e-08 AT2G31081 57 / 2e-12 CLAVATA3/ESR-RELATED 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015304 pacid=23178750 polypeptide=Lus10015304 locus=Lus10015304.g ID=Lus10015304.BGIv1.0 annot-version=v1.0 ATGGCTGGCCTTAAGAGTTTGTTGTGCGTAATGACAATCCTGGCATTGCTCTCATTTCCATCTTGTTCCGAAAGCCGGCCTTTGAATCCTCCGTCCACGA CAACACGTGGCATCATCAAGGCGATTCGAGCGCTTGGCGAGAGGCGTGCTGGAAGTGGGAGTGCCAAGGGTCGAGATGCTACTGCTGCTTATGATGCTTC CAAGAGGTCTAGCCCCGGAGGACCTGATCCGCACCACCATTGA
AA sequence Show only first row Show all	>Lus10015304 pacid=23178750 polypeptide=Lus10015304 locus=Lus10015304.g ID=Lus10015304.BGIv1.0 annot-version=v1.0 MAGLKSLLCVMTILALLSFPSCSESRPLNPPSTTTRGIIKAIRALGERRAGSGSAKGRDATAAYDASKRSSPGGPDPHHH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G31081		CLE4	CLAVATA3/ESR-RELATED 4 (.1)		Lus10015304 [exp]	0	1
AT4G38580		HIPP26, ATFP6	HEAVY METAL ASSOCIATED ISOPREN...		Lus10019789 [exp]	8.4	0.7559
AT2G23540			GDSL-like Lipase/Acylhydrolase...		Lus10016775 [exp]	9.5	0.8320
AT5G61680			Pectin lyase-like superfamily ...		Lus10034893 [exp]	10.7	0.8300
AT3G07970		QRT2	QUARTET 2, Pectin lyase-like s...		Lus10019711 [exp]	19.4	0.8166
AT1G11920			Pectin lyase-like superfamily ...		Lus10011257 [exp]	20.4	0.7724
AT2G23540			GDSL-like Lipase/Acylhydrolase...		Lus10022471 [exp]	23.6	0.8169
AT5G25900		ATKO1, CYP701A3...	CYTOCHROME P450 701 A3, ARABID...		Lus10032747 [exp]	28.9	0.7988
AT5G55180			O-Glycosyl hydrolases family 1...		Lus10040600 [exp]	29.2	0.8083
AT3G50990			Peroxidase superfamily protein...		Lus10030940 [exp]	32.0	0.7160
AT5G55840			Pentatricopeptide repeat (PPR)...		Lus10038697 [exp]	32.4	0.7005

Compare expression of checked genes

Lus10015304 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.