Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28330 118 / 2e-35 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) AT2G33830 111 / 4e-33 Dormancy/auxin associated family protein (.1.2) AT5G44300 103 / 1e-29 Dormancy/auxin associated family protein (.1) AT1G56220 44 / 9e-07 Dormancy/auxin associated family protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025446 [exp] 159 / 3e-52 AT2G33830 82 / 4e-22 Dormancy/auxin associated family protein (.1.2) Lus10013997 [exp] 115 / 1e-34 AT1G28330 119 / 4e-36 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10015418 [exp] 113 / 1e-33 AT1G28330 120 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10013996 [exp] 81 / 4e-21 AT1G28330 74 / 2e-18 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10031488 [exp] 45 / 1e-06 AT1G56220 136 / 3e-42 Dormancy/auxin associated family protein (.1.2.3.4) Lus10015193 [exp] 44 / 3e-06 AT1G56220 134 / 3e-41 Dormancy/auxin associated family protein (.1.2.3.4) Lus10020661 [exp] 42 / 2e-05 AT1G56220 126 / 2e-38 Dormancy/auxin associated family protein (.1.2.3.4) Lus10029881 [exp] 42 / 4e-05 AT5G27830 245 / 9e-80 unknown protein Lus10008142 [exp] 37 / 0.0008 AT1G54070 65 / 1e-14 Dormancy/auxin associated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G047100 [exp] 87 / 9e-23 AT1G28330 122 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Potri.013G014900 [exp] 44 / 2e-06 AT1G56220 97 / 7e-27 Dormancy/auxin associated family protein (.1.2.3.4) Potri.005G024250 [exp] 42 / 4e-06 AT1G56220 86 / 2e-23 Dormancy/auxin associated family protein (.1.2.3.4) Potri.001G164800 [exp] 40 / 4e-05 AT1G54070 67 / 3e-15 Dormancy/auxin associated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05564 [flax] [poplar] Auxin_repressed Dormancy/auxin associated protein
Representative CDS sequence Show only first row Show all	>Lus10015318 pacid=23178732 polypeptide=Lus10015318 locus=Lus10015318.g ID=Lus10015318.BGIv1.0 annot-version=v1.0 ATGGTGTTGCTTGATAACTTTTGGGACGACGTGGTGGCTGGTCCTCAGCCTGAGCGTGGCCTCGGCCGCCTCCGTGGCACCGCCAAGCCCTTGACCATTC CAGATGGGGATGCTGGAGGGAGCTTGCAGCTCCAGAAGCCAGCAGCAATGCCGGAGAGCCCGAGGACTCCAGCGACACCAGGATCCGCGACGAAGGACAA TGTGTGGAGGAGTGTGTTCAACCCAGGGAGCAACCTGGCCACCAGGTCCGGTCACGCCATGTACGACAACGTCAGCCCGACCCAGGCTAACAATCCCACA ACCTATGACTGGCTTTACAGCGGGGATAGTAGGAGCACGCATCGCTGA
AA sequence Show only first row Show all	>Lus10015318 pacid=23178732 polypeptide=Lus10015318 locus=Lus10015318.g ID=Lus10015318.BGIv1.0 annot-version=v1.0 MVLLDNFWDDVVAGPQPERGLGRLRGTAKPLTIPDGDAGGSLQLQKPAAMPESPRTPATPGSATKDNVWRSVFNPGSNLATRSGHAMYDNVSPTQANNPT TYDWLYSGDSRSTHR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G28330		DYL1, DRM1	DORMANCY-ASSOCIATED PROTEIN 1,...		Lus10015318 [exp]	0	1
AT2G33830			Dormancy/auxin associated fami...		Lus10025446 [exp]	1.0	0.9008
AT1G52240		PIRF1, ATROPGEF...	phytochrome interacting RopGEF...		Lus10011443 [exp]	1.4	0.8732
AT5G22920			CHY-type/CTCHY-type/RING-type ...		Lus10023914 [exp]	3.2	0.8171
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10012570 [exp]	4.0	0.8619
AT4G29670		ACHT2	atypical CYS HIS rich thiored...		Lus10007994 [exp]	5.2	0.8666
AT5G03260		LAC11	laccase 11 (.1)		Lus10013800 [exp]	6.7	0.8046
AT2G02950		PKS1	phytochrome kinase substrate 1...		Lus10036746 [exp]	9.2	0.8243
AT3G10060			FKBP-like peptidyl-prolyl cis-...		Lus10035560 [exp]	11.6	0.8375
AT5G59550			zinc finger (C3HC4-type RING f...		Lus10010856 [exp]	12.7	0.8175
AT5G56550		ATOXS3	oxidative stress 3 (.1)		Lus10043039 [exp]	12.8	0.8146

Compare expression of checked genes

Lus10015318 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.