Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30010 146 / 1e-47 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001443 [exp] 185 / 6e-63 AT4G30010 146 / 2e-47 unknown protein Lus10025458 [exp] 184 / 2e-62 AT4G30010 142 / 4e-46 unknown protein Lus10001623 [exp] 184 / 2e-62 AT4G30010 144 / 7e-47 unknown protein Lus10001622 [exp] 101 / 4e-27 AT2G18980 320 / 4e-109 Peroxidase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G075600 [exp] 167 / 5e-56 AT4G30010 134 / 9e-43 unknown protein Potri.018G142500 [exp] 165 / 5e-55 AT4G30010 137 / 8e-44 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015329 pacid=23178736 polypeptide=Lus10015329 locus=Lus10015329.g ID=Lus10015329.BGIv1.0 annot-version=v1.0 ATGGCGATGAGGAGGTTCTACAGCGAGATCAAGGGGTTGAAGGTGAAGGAGGTTCCGAACCACGTGAAGCCGATGCTGTCGCTCGACTTCGTGAAGAAAT CGGTGCAGAAAGGATTGGACAATTACCACGCTAAGTACATCCAGACCAGCTCCGTCGATCCTCTCTTGCACGTCTGCTTCGGCGGGATGGCTTTCTCCTA TCTTGTCGCCCTTCCCGAGGAGCGTCGCCATCTGGAGCACCAGCAGCACGCCAAAGAGCACGGCGGCCATTGA
AA sequence Show only first row Show all	>Lus10015329 pacid=23178736 polypeptide=Lus10015329 locus=Lus10015329.g ID=Lus10015329.BGIv1.0 annot-version=v1.0 MAMRRFYSEIKGLKVKEVPNHVKPMLSLDFVKKSVQKGLDNYHAKYIQTSSVDPLLHVCFGGMAFSYLVALPEERRHLEHQQHAKEHGGH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30010			unknown protein		Lus10015329 [exp]	0	1
AT5G52840			NADH-ubiquinone oxidoreductase...		Lus10039296 [exp]	4.7	0.8983
AT2G42210		ATOEP16-3	Mitochondrial import inner mem...		Lus10012024 [exp]	4.9	0.9115
AT2G42310			unknown protein		Lus10042351 [exp]	4.9	0.8573
AT2G33040		ATP3	gamma subunit of Mt ATP syntha...		Lus10007534 [exp]	7.7	0.8921
AT4G25390			Protein kinase superfamily pro...		Lus10027393 [exp]	8.1	0.8770
AT3G10860			Cytochrome b-c1 complex, subun...		Lus10019118 [exp]	10.8	0.8529
AT5G52840			NADH-ubiquinone oxidoreductase...		Lus10027539 [exp]	11.6	0.8931
AT4G37830			cytochrome c oxidase-related (...		Lus10011574 [exp]	13.4	0.8484
AT3G58730			vacuolar ATP synthase subunit ...		Lus10038979 [exp]	13.7	0.8538
AT1G30480		DRT111	DNA-DAMAGE-REPAIR/TOLERATION P...		Lus10023355 [exp]	14.5	0.8722

Compare expression of checked genes

Lus10015329 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.