Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30160 115 / 6e-31 ATVLN4, VLN4 villin 4 (.1.2) AT5G57320 100 / 1e-25 VLN5 villin 5, villin, putative (.1) AT2G29890 82 / 4e-19 ATVLN1, VLN1 villin 1, villin-like 1 (.1.2.3) AT3G57410 70 / 6e-15 ATVLN3, VLN3 villin 3 (.1) AT2G41740 63 / 9e-13 ATVLN2, VLN2 villin 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015333 [exp] 199 / 1e-60 AT4G30160 1395 / 0.0 villin 4 (.1.2) Lus10025461 [exp] 196 / 7e-60 AT4G30160 959 / 0.0 villin 4 (.1.2) Lus10005861 [exp] 92 / 9e-23 AT2G29890 1049 / 0.0 villin 1, villin-like 1 (.1.2.3) Lus10035450 [exp] 72 / 1e-15 AT2G41740 1402 / 0.0 villin 2 (.1) Lus10031066 [exp] 72 / 1e-15 AT2G41740 1320 / 0.0 villin 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G165300 [exp] 142 / 1e-40 AT4G30160 1507 / 0.0 villin 4 (.1.2) Potri.018G089700 [exp] 138 / 4e-39 AT4G30160 1464 / 0.0 villin 4 (.1.2) Potri.009G045000 [exp] 97 / 2e-24 AT2G29890 1101 / 0.0 villin 1, villin-like 1 (.1.2.3) Potri.006G050200 [exp] 69 / 8e-15 AT2G41740 1340 / 0.0 villin 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02209 [flax] [poplar] VHP Villin headpiece domain
Representative CDS sequence Show only first row Show all	>Lus10015334 pacid=23178743 polypeptide=Lus10015334 locus=Lus10015334.g ID=Lus10015334.BGIv1.0 annot-version=v1.0 ATGGCAAGAACAGTCAAAGCAAATTCTCAAGGTCCAAAATCAACACCGGCGGAATCAGACTCCAAAGGAGGGGACTCAATGAGCAGCAGGATGGAGTCTC TTTCAATAAAGGAAGATGCGAAAGAGCACGAACCCGAGGATGAAGAAGGGCTCCCGATTTTCCCATATGACCGGGTCAAAGTTAACGCAGAAGATCCTGC TGATGAGATTGATGTGACCAAGCGCGAAACATATCTATCGTCGGCGGAGTTCAAGGAGAAATTCGGGATGGGGAAGGATGCATTCTATAAGTTGCCTAAA TGGAAACAGAACAAGCTCAAAATGGCTATTCAATTATTCTGA
AA sequence Show only first row Show all	>Lus10015334 pacid=23178743 polypeptide=Lus10015334 locus=Lus10015334.g ID=Lus10015334.BGIv1.0 annot-version=v1.0 MARTVKANSQGPKSTPAESDSKGGDSMSSRMESLSIKEDAKEHEPEDEEGLPIFPYDRVKVNAEDPADEIDVTKRETYLSSAEFKEKFGMGKDAFYKLPK WKQNKLKMAIQLF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30160		ATVLN4, VLN4	villin 4 (.1.2)		Lus10015334 [exp]	0	1
AT5G14790			ARM repeat superfamily protein...		Lus10032152 [exp]	16.4	0.7177
AT1G79830		GC5	golgin candidate 5 (.1.2.3.4)		Lus10037556 [exp]	32.1	0.6935
AT5G53550		ATYSL3, YSL3	YELLOW STRIPE like 3 (.1.2)		Lus10012053 [exp]	45.7	0.6640
AT4G10570		UBP9	ubiquitin-specific protease 9 ...		Lus10017343 [exp]	57.8	0.6250
AT5G23400			Leucine-rich repeat (LRR) fami...		Lus10041010 [exp]	64.4	0.6487
AT1G10750			Protein of Unknown Function (D...		Lus10013046 [exp]	79.4	0.6521
AT5G05950		MEE60	maternal effect embryo arrest ...		Lus10000398 [exp]	96.0	0.6160
AT3G44510			alpha/beta-Hydrolases superfam...		Lus10004879 [exp]	99.9	0.5875
AT3G14310		ATPME3	pectin methylesterase 3 (.1)		Lus10003933 [exp]	135.0	0.6136
AT1G19835			Plant protein of unknown funct...		Lus10034510 [exp]	222.5	0.5825

Compare expression of checked genes

Lus10015334 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.