Lus10015336 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025720 55 / 3e-10 ND /
Lus10010044 42 / 4e-05 ND /
Lus10028156 39 / 0.0007 AT3G60240 1275 / 0.0 CUCUMOVIRUS MULTIPLICATION 2, eukaryotic translation initiation factor 4G (.2.3.4)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10015336 pacid=23160888 polypeptide=Lus10015336 locus=Lus10015336.g ID=Lus10015336.BGIv1.0 annot-version=v1.0
ATGGCTGCCAAAACTACTACAGTAATCAAGGACAGTGATAAGGATTGGGACAAGACAAGGCCATTCTTCGGATCTTCACGTGCTGGTATCCATAAGCCTC
GGTGTTGGATGCAGGACGACAGAGACAGCACAACGAGTATGGAGGCGATAACGGTAGACATTGAAGAGTATGCAGAGGCAGTGGTGGCCCACATTATTGT
CAAACATACTCGGTTGGTGACTAGAGGAGCAATTATTCAAGAGATCCGCCCAATTCCTTGCATTCCTCAAAAGATATGTCTGCAGATAGTCTGGAGAGCA
GGTAACGGGTTCGCCCTAGTGGCTCGCATGACCCATAGATATCTTCCGGGAGTATTGCCGATAGTCCTCACTTTTTGGATTGATTTTTAG
AA sequence
>Lus10015336 pacid=23160888 polypeptide=Lus10015336 locus=Lus10015336.g ID=Lus10015336.BGIv1.0 annot-version=v1.0
MAAKTTTVIKDSDKDWDKTRPFFGSSRAGIHKPRCWMQDDRDSTTSMEAITVDIEEYAEAVVAHIIVKHTRLVTRGAIIQEIRPIPCIPQKICLQIVWRA
GNGFALVARMTHRYLPGVLPIVLTFWIDF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10015336 0 1
AT1G14590 Nucleotide-diphospho-sugar tra... Lus10041976 5.2 0.8949
AT5G65530 Protein kinase superfamily pro... Lus10012727 7.7 0.8688
Lus10024012 8.7 0.8263
Lus10037868 9.3 0.8634
AT5G06210 RNA binding (RRM/RBD/RNP motif... Lus10004224 9.7 0.7356
AT4G37110 Zinc-finger domain of monoamin... Lus10021004 10.1 0.7864
AT5G01660 unknown protein Lus10040599 11.3 0.8624
AT5G06920 FLA21 FASCICLIN-like arabinogalactan... Lus10016437 12.0 0.8106
Lus10029261 12.6 0.8624
AT5G56990 unknown protein Lus10029528 13.9 0.8624

Lus10015336 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.