Plant FIBer expression Database

Lus10015338 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G04650 92 / 7e-23 ADP-glucose pyrophosphorylase family protein (.1)
AT1G74910 87 / 5e-21 ADP-glucose pyrophosphorylase family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042942
[exp]
93 / 3e-23 AT1G74910 734 / 0.0 ADP-glucose pyrophosphorylase family protein (.1.2.3)
Lus10032440
[exp]
92 / 6e-23 AT1G74910 747 / 0.0 ADP-glucose pyrophosphorylase family protein (.1.2.3)
Lus10039455
[exp]
79 / 4e-18 AT3G01330 299 / 2e-97 E2F-LIKE 2, DP-E2F-like protein 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G075500
[exp]
91 / 1e-22 AT1G74910 717 / 0.0 ADP-glucose pyrophosphorylase family protein (.1.2.3)
Potri.015G070500
[exp]
91 / 2e-22 AT1G74910 736 / 0.0 ADP-glucose pyrophosphorylase family protein (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10015338 pacid=23160949 polypeptide=Lus10015338 locus=Lus10015338.g ID=Lus10015338.BGIv1.0 annot-version=v1.0
ATGGTAGTAGGTTCTTTCTGTTTCCAAGTTGCTAGGAAATGTGAGTGTTCTCAGTATGTTTTTGCTTCAAGGTACCTGAAAGAGGACAGGCCACATGGTT
CAGCTGGGAGTCTTTACTATTTTAGGGACATCATCATGGAAGACAATCCGGTATCTGCGGAATCAGCGAGCCAGTTTGGTGAATTAGCTGCAGATCCGAA
TACCAAAGAACTGCTGCATTATCCAGAAAAACCTGAGACATTTATGAAAAATCCAGAATGTTTCCTAAATGCAGGAGAAGCTGTAACGGTAGAAGATGAG
GTAGTGGTGACCAACTGCATTGTTCTTCCGAACAAGACAATTAACGTTAGTGTCCAGGAAGAGATCATCCTGTAG
AA sequence
>Lus10015338 pacid=23160949 polypeptide=Lus10015338 locus=Lus10015338.g ID=Lus10015338.BGIv1.0 annot-version=v1.0
MVVGSFCFQVARKCECSQYVFASRYLKEDRPHGSAGSLYYFRDIIMEDNPVSAESASQFGELAADPNTKELLHYPEKPETFMKNPECFLNAGEAVTVEDE
VVVTNCIVLPNKTINVSVQEEIIL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G74910 ADP-glucose pyrophosphorylase ... Lus10015338
[exp]
0 1
AT4G18380 F-box family protein (.1.2) Lus10013431
[exp]
6.5 0.8585
AT5G66680 DGL1 DEFECTIVE GLYCOSYLATION, dolic... Lus10009792
[exp]
7.3 0.8079
AT1G11340 S-locus lectin protein kinase ... Lus10030768
[exp]
8.0 0.8414
AT3G14130 Aldolase-type TIM barrel famil... Lus10013173
[exp]
8.7 0.8537
Lus10002266
[exp]
8.9 0.8626
AT1G54870 NAD(P)-binding Rossmann-fold s... Lus10033745
[exp]
10.9 0.8415
AT3G03990 alpha/beta-Hydrolases superfam... Lus10013541
[exp]
11.0 0.8169
AT2G44480 BGLU17 beta glucosidase 17 (.1.2) Lus10037473
[exp]
11.2 0.8282
AT5G60900 RLK1 receptor-like protein kinase 1... Lus10024195
[exp]
11.7 0.8436
AT2G03620 AtMRS2-5, AtMGT... magnesium transporter 3 (.1.2) Lus10037081
[exp]
13.5 0.8302

Lus10015338 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.