Lus10015356 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62740 506 / 0 AtHIR4, ATHIR1 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT3G01290 483 / 1e-174 AtHIR2 hypersensitive induced reaction 2, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT1G69840 458 / 1e-164 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
AT5G51570 348 / 4e-121 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT5G54100 62 / 9e-11 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT4G27585 54 / 4e-08 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007268 581 / 0 AT5G62740 510 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10033099 521 / 0 AT5G62740 533 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10004268 496 / 1e-179 AT5G62740 535 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10036715 466 / 1e-167 AT1G69840 516 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
Lus10037213 464 / 7e-167 AT1G69840 514 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
Lus10038907 336 / 3e-116 AT5G51570 529 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015032 335 / 6e-116 AT5G51570 532 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10032909 60 / 7e-10 AT4G27585 498 / 4e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G078100 523 / 0 AT5G62740 488 / 3e-176 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G070500 498 / 1e-180 AT5G62740 484 / 3e-175 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.017G078000 487 / 3e-176 AT5G62740 518 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G130600 349 / 1e-121 AT5G51570 510 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G129000 342 / 9e-119 AT5G51570 480 / 4e-173 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G065001 294 / 5e-101 AT5G62740 312 / 4e-108 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G001900 59 / 9e-10 AT4G27585 499 / 2e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G005500 59 / 1e-09 AT4G27585 463 / 3e-162 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G009800 58 / 2e-09 AT4G27585 382 / 3e-130 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0433 SPFH PF01145 Band_7 SPFH domain / Band 7 family
Representative CDS sequence
>Lus10015356 pacid=23160873 polypeptide=Lus10015356 locus=Lus10015356.g ID=Lus10015356.BGIv1.0 annot-version=v1.0
ATGGGTAATCTGTCATGCTGTGTGAAAGTGGATCAGTCAACAGTAGCAGTGAAGGAAAGGTTTGGTAGGTTTGAGAAAGTGCTTGAGCCAGGGTGCCATT
GCATGCCTTGGTTCCTTGGAAGAAGTGTTGTTGGCAAGCTCTCCTTGCGCCTTCAGCAGCTAGATGTCCGTTGTGAGACCAAGACCAAGGACAATGTGTT
TGTGAATGTTGTTGCTTCAGTGCAATACAGAGCACTCGCCCAGAAAGCAAGCGACGCTTTCTACAAGCTCAGCAACACCAGGTCCCAAATTCAGGCCTAC
GTTTTCGACGTGATCAGAGCAAGTGTTCCAAAGCTGAACCTTGATGATGCTTTTGAGCAGAAGAACGAGATTGCCAAGGCTGTTGAAGATGAACTCGAGA
AGGCCATGTCCGCATATGGGTATGAAATTGTGCAGACACTAATTGTTGATATTGAGCCTGACGAGCGTGTGAAGAAGGCGATGAACGAGATCAATGCTGC
TGCAAGAATGAGGCTGGCTGCAAACGAGAAAGCAGAGGCGGAGAAGATAGTCCAGATCAAGAGAGCAGAAGGAGATGCAGAATCAAAGTTCCTGTCAGGG
CTTGGGATCGCACGTCAGCGTCAGGCTATTGTTGACGGTCTGAGGGACAGTGTTCTGGGTTTCTCCGGCAACGTCCCAGGAACCTCAGCTAAGGATGTTC
TGGACATGGTTCTCATTACCCAATACTTCGATACCATGAAGGAGATAGGTGCTACCAGCAAGTCCTCTGCAGTGTTCATCCCACATGGTCCAGGGGCCGT
CAATGAAATTGCAGCCCAGGTTCGCGATGGACTCCTTCAGGCTAACCCTCTCAAGTGA
AA sequence
>Lus10015356 pacid=23160873 polypeptide=Lus10015356 locus=Lus10015356.g ID=Lus10015356.BGIv1.0 annot-version=v1.0
MGNLSCCVKVDQSTVAVKERFGRFEKVLEPGCHCMPWFLGRSVVGKLSLRLQQLDVRCETKTKDNVFVNVVASVQYRALAQKASDAFYKLSNTRSQIQAY
VFDVIRASVPKLNLDDAFEQKNEIAKAVEDELEKAMSAYGYEIVQTLIVDIEPDERVKKAMNEINAAARMRLAANEKAEAEKIVQIKRAEGDAESKFLSG
LGIARQRQAIVDGLRDSVLGFSGNVPGTSAKDVLDMVLITQYFDTMKEIGATSKSSAVFIPHGPGAVNEIAAQVRDGLLQANPLK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62740 AtHIR4, ATHIR1 hypersensitive induced reactio... Lus10015356 0 1
AT3G06270 Protein phosphatase 2C family ... Lus10041242 6.0 0.8498
AT1G21090 Cupredoxin superfamily protein... Lus10028576 8.0 0.8590
AT2G18500 OFP ATOFP7, OFP7 ARABIDOPSIS THALIANA OVATE FAM... Lus10041730 12.2 0.8708
AT2G20515 unknown protein Lus10024890 19.5 0.8610
AT2G34930 disease resistance family prot... Lus10033931 20.9 0.8077
AT2G14660 unknown protein Lus10033766 22.2 0.8429
AT2G44380 Cysteine/Histidine-rich C1 dom... Lus10037470 22.6 0.8139
AT5G09550 GDP dissociation inhibitor fam... Lus10035634 22.7 0.8598
AT3G06270 Protein phosphatase 2C family ... Lus10021952 25.8 0.8316
AT3G50870 GATA GATA18, HAN, MN... MONOPOLE, HANABA TANARU, GATA ... Lus10041746 31.3 0.8330

Lus10015356 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.