Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01270 42 / 2e-05 Pectate lyase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007266 [exp] 161 / 1e-52 ND / Lus10030669 [exp] 111 / 6e-33 ND 40 / 1e-04 Lus10033018 [exp] 53 / 4e-09 AT5G15110 561 / 0.0 Pectate lyase family protein (.1) Lus10005254 [exp] 47 / 6e-07 AT3G01270 558 / 0.0 Pectate lyase family protein (.1) Lus10030670 [exp] 44 / 3e-06 AT3G01270 558 / 0.0 Pectate lyase family protein (.1) Lus10037207 [exp] 39 / 0.0002 AT3G01270 561 / 0.0 Pectate lyase family protein (.1) Lus10036721 [exp] 37 / 0.001 AT3G01270 565 / 0.0 Pectate lyase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G124100 [exp] 61 / 4e-12 AT5G15110 533 / 0.0 Pectate lyase family protein (.1) Potri.017G078400 [exp] 57 / 1e-10 AT5G15110 481 / 7e-168 Pectate lyase family protein (.1) Potri.015G064700 [exp] 41 / 4e-05 AT5G15110 511 / 5e-180 Pectate lyase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04431 [flax] [poplar] Pec_lyase_N Pectate lyase, N terminus
Representative CDS sequence Show only first row Show all	>Lus10015358 pacid=23160936 polypeptide=Lus10015358 locus=Lus10015358.g ID=Lus10015358.BGIv1.0 annot-version=v1.0 ATGGAGACTTCAACCAAGCTAGTTTTGATCATGGCCCTCTGTTTGGGGGTGATGATTCAAACCTTGAATGCCGACGTGGGCGTCTATGATAATGTTTGGC AGAAGCGAGCCGAAGAAGCCAAAAAAAACACCATGGATGCCTACATTCCGGAAGTCATGGAAGTTAGCAATGAAAAAAATGCCGGCACCGCAACCGTGGC CGTCCAGTCAGCTACCGGTGAGGTCAAGGTTCCTGGAGCCAGCGCTCCAGCTTCTGGTGAGGTCACGGCTCCTGTAGCCACTGCTCCGGCGGCGGCCACC CCAGAGCCTGCCATCAAACAAAGATAA
AA sequence Show only first row Show all	>Lus10015358 pacid=23160936 polypeptide=Lus10015358 locus=Lus10015358.g ID=Lus10015358.BGIv1.0 annot-version=v1.0 METSTKLVLIMALCLGVMIQTLNADVGVYDNVWQKRAEEAKKNTMDAYIPEVMEVSNEKNAGTATVAVQSATGEVKVPGASAPASGEVTAPVATAPAAAT PEPAIKQR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10015358 [exp]	0	1

Compare expression of checked genes

Lus10015358 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.