Lus10015367 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26870 285 / 2e-93 NAC FEZ, ANAC009 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
AT5G39820 266 / 3e-87 NAC ANAC094 NAC domain containing protein 94 (.1)
AT2G43000 219 / 1e-69 NAC ANAC042, JUB1, JUNGBRUNNEN1 NAC domain containing protein 42 (.1)
AT3G12910 184 / 5e-56 NAC NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
AT2G02450 186 / 8e-56 NAC LOV1, ANAC034, ANAC035 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2)
AT3G15510 179 / 3e-53 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
AT3G04070 176 / 2e-52 NAC ANAC047 NAC domain containing protein 47 (.1.2)
AT1G01720 173 / 9e-52 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
AT1G61110 174 / 1e-51 NAC ANAC025 NAC domain containing protein 25 (.1)
AT4G27410 172 / 2e-51 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007263 535 / 0 AT5G39820 300 / 3e-100 NAC domain containing protein 94 (.1)
Lus10036749 288 / 2e-94 AT1G26870 306 / 4e-100 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Lus10037178 288 / 4e-94 AT5G39820 306 / 3e-101 NAC domain containing protein 94 (.1)
Lus10030478 278 / 6e-91 AT5G39820 297 / 4e-98 NAC domain containing protein 94 (.1)
Lus10031189 221 / 3e-69 AT3G12910 264 / 9e-87 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Lus10031767 213 / 4e-68 AT2G43000 236 / 3e-78 NAC domain containing protein 42 (.1)
Lus10007410 189 / 4e-57 AT3G15510 241 / 1e-78 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Lus10038332 186 / 6e-57 AT2G43000 231 / 1e-75 NAC domain containing protein 42 (.1)
Lus10036117 187 / 2e-56 AT3G15510 241 / 2e-78 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G082000 306 / 4e-102 AT1G26870 299 / 3e-98 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.004G126901 305 / 1e-101 AT5G39820 305 / 1e-101 NAC domain containing protein 94 (.1)
Potri.007G066300 221 / 4e-70 AT3G12910 269 / 2e-89 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.005G098000 218 / 7e-69 AT3G12910 271 / 2e-90 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.002G057200 214 / 2e-67 AT2G43000 282 / 4e-95 NAC domain containing protein 42 (.1)
Potri.005G205400 211 / 3e-66 AT2G43000 269 / 6e-90 NAC domain containing protein 42 (.1)
Potri.003G149700 206 / 2e-64 AT2G43000 245 / 2e-80 NAC domain containing protein 42 (.1)
Potri.001G080900 204 / 8e-64 AT2G43000 257 / 3e-85 NAC domain containing protein 42 (.1)
Potri.004G038000 188 / 8e-57 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1)
Potri.011G046700 188 / 8e-57 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02365 NAM No apical meristem (NAM) protein
Representative CDS sequence
>Lus10015367 pacid=23160929 polypeptide=Lus10015367 locus=Lus10015367.g ID=Lus10015367.BGIv1.0 annot-version=v1.0
ATGGAGGAGAAAGGTGAGGTGGAGGAGGAGATGCTACCTGGTTTCCGTTTTCACCCGACTGACGAGGAGTTGGTTGGGTTTTACCTGAGGAGGAAAATAC
AGCACCGTACTCTTTCTATTGAACTCATCAAGCAGGTTGATATTTACAAATACGATCCCTGGGATCTTCCAAAGCTGGCGACAACAGGGGAGAAAGAGTG
GTATTTCTACTGTCCAAGAGACCGTAAATACAGGAACAGCGCCAGGCCGAACCGGGTTACCGGAGCCGGTTTCTGGAAGGCAACCGGAACAGACCGGCCT
ATATATTCATCGGAAGGAAGCAAATGCATAGGGTTGAAGAAATCACTGGTTTTTTACAGAGGACGAGCTGCAAAAGGCATCAAAACCGACTGGATGATGC
ATGAGTTCCGTCTCCCTCCTCTTCCTGACCGTTCCCCTTCCCCACCTCATCCTCCTCCTAAGAAGCTCCTCCTCGACAAAACCCTTCCTCCCAATGAAAC
TTGGGCGATTTGCCGGATATTCAAGAAGACCAATTCAATGGCTCAAAGAGCTCTTTCCCATCCATGGATGTCGTCCCCTATGCTTCCTCCTGCTGACAAC
TCCTCCCATATATTCAACCACAACCCTTCACAACTTGGATCATCACTTGTCTTCCAGCAACAACCCATGTTTCCATTCCCAGCTTGTGCCACTAACAACA
ATTTCATCTTCCCTCCAATCGGCTCTTCAATTCCACCCAAGACGACCCTGATTTCGGATCCTACTACTTCTGAATCTCTAGAATTCAGTGGATTCTCTAT
CCGTAATTTGCAACATAGCTTGGAAAGTAGTGCTGACCAGGGAGACGATTTGAGGAAGAACAACAATATTAATCAGTGGGATGGGATTGGGAATGGGAAT
GGGATGAGGTCGTCGTCAATTGGATTTCCATTCAGTTTGCCAACAGATGATGATGTTTGGGATACGGTGGTGCATCCAGCTGGTGACATGTCCAGTAACG
CTGCTTGTTATTCCACAAACAAATGCTACACTTAA
AA sequence
>Lus10015367 pacid=23160929 polypeptide=Lus10015367 locus=Lus10015367.g ID=Lus10015367.BGIv1.0 annot-version=v1.0
MEEKGEVEEEMLPGFRFHPTDEELVGFYLRRKIQHRTLSIELIKQVDIYKYDPWDLPKLATTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRP
IYSSEGSKCIGLKKSLVFYRGRAAKGIKTDWMMHEFRLPPLPDRSPSPPHPPPKKLLLDKTLPPNETWAICRIFKKTNSMAQRALSHPWMSSPMLPPADN
SSHIFNHNPSQLGSSLVFQQQPMFPFPACATNNNFIFPPIGSSIPPKTTLISDPTTSESLEFSGFSIRNLQHSLESSADQGDDLRKNNNINQWDGIGNGN
GMRSSSIGFPFSLPTDDDVWDTVVHPAGDMSSNAACYSTNKCYT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G26870 NAC FEZ, ANAC009 FEZ, Arabidopsis NAC domain co... Lus10015367 0 1
Lus10033739 8.0 0.8716
AT1G67710 GARP ARR11 response regulator 11 (.1) Lus10006446 11.9 0.8923
AT4G24040 TREHALASE1, ATT... trehalase 1 (.1) Lus10023035 14.0 0.9009
AT2G24700 B3 REM10 Transcriptional factor B3 fami... Lus10026264 14.1 0.8697
AT3G07680 emp24/gp25L/p24 family/GOLD fa... Lus10036603 15.5 0.9039
AT1G60790 TBL2 TRICHOME BIREFRINGENCE-LIKE 2,... Lus10030590 21.1 0.8847
AT5G26250 Major facilitator superfamily ... Lus10002452 24.5 0.8477
AT2G23520 Pyridoxal phosphate (PLP)-depe... Lus10022447 28.4 0.8856
AT3G13050 AtNiaP nicotinate transporter, Major ... Lus10037295 35.8 0.8222
AT2G41510 ATCKX1, CKX1 cytokinin oxidase/dehydrogenas... Lus10035433 36.1 0.8220

Lus10015367 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.