Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G15280 54 / 4e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G20090 52 / 1e-08 EMB1025 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G61990 51 / 3e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G66345 49 / 1e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G64583 49 / 2e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G65560 48 / 4e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G11690 47 / 5e-07 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G01110 47 / 6e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G07290 46 / 1e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G09680 46 / 2e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033008 [exp] 116 / 3e-31 AT5G15280 889 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10021989 [exp] 49 / 3e-07 AT5G65560 498 / 2e-157 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10042529 [exp] 48 / 3e-07 AT5G65560 498 / 1e-160 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10023863 [exp] 47 / 1e-06 AT5G12100 728 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10008185 [exp] 46 / 2e-06 AT1G19290 864 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10012068 [exp] 46 / 2e-06 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027916 [exp] 46 / 2e-06 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027914 [exp] 46 / 2e-06 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10042016 [exp] 45 / 3e-06 AT2G32630 600 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G086000 [exp] 71 / 5e-15 AT5G15280 984 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.014G040200 [exp] 54 / 2e-09 AT1G19290 883 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G045000 [exp] 52 / 1e-08 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G014500 [exp] 51 / 3e-08 AT1G09820 696 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.006G271200 [exp] 50 / 4e-08 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G034200 [exp] 50 / 4e-08 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G032600 [exp] 50 / 5e-08 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G034300 [exp] 49 / 1e-07 AT1G62930 397 / 4e-133 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G250700 [exp] 48 / 3e-07 AT3G54980 781 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G276500 [exp] 48 / 4e-07 AT5G01110 863 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10015374 pacid=23160872 polypeptide=Lus10015374 locus=Lus10015374.g ID=Lus10015374.BGIv1.0 annot-version=v1.0 ATGGCATTAAACCTGAAAGACCTGATGGTAAGAGAAACCGAGTGCGACAGACTTGTCATTTACAATATCCTAGTTTTCAGTCTGCTTAGAGCAGGAAACA GGTTTCTTGCAAGGAGGATTCTGAATGAAATGGAGGAAAAAGGATTAGAATTCAACGATGCCAAGCACCAGCAGCTTGAGAAGTCTAGTATGAAAACATG GAGTGTGCTGATTTGGAAGATGTGCGAACAAGGACGTCCTGCAGAAGCAGAAGAGCTTCTCCATGGGATGGTTGCAGCCGGTGAAGTCCCTGGAAGGGAG CTATACAGTTGCGTAATCGATGGGTACCATGCAGAGAACAATGTGAGAGTCTTCAGAAGTGATGAGAAGGATGCAGGAAAGTGGGCATGA
AA sequence Show only first row Show all	>Lus10015374 pacid=23160872 polypeptide=Lus10015374 locus=Lus10015374.g ID=Lus10015374.BGIv1.0 annot-version=v1.0 MALNLKDLMVRETECDRLVIYNILVFSLLRAGNRFLARRILNEMEEKGLEFNDAKHQQLEKSSMKTWSVLIWKMCEQGRPAEAEELLHGMVAAGEVPGRE LYSCVIDGYHAENNVRVFRSDEKDAGKWA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G15280			Pentatricopeptide repeat (PPR)...		Lus10015374 [exp]	0	1
AT4G14368			Regulator of chromosome conden...		Lus10038991 [exp]	1.0	0.8762
AT4G37360		CYP81D2	"cytochrome P450, family 81, s...		Lus10018719 [exp]	2.0	0.8072
AT1G30920			F-box family protein (.1)		Lus10006734 [exp]	9.8	0.7171
AT2G24100		ASG1	ALTERED SEED GERMINATION 1, un...		Lus10029847 [exp]	17.1	0.6449
AT3G08030			Protein of unknown function, D...		Lus10029502 [exp]	18.5	0.6335
AT2G24370			Protein kinase protein with ad...		Lus10027593 [exp]	19.8	0.6335
					Lus10004437 [exp]	21.0	0.6335
AT3G18170			Glycosyltransferase family 61 ...		Lus10032454 [exp]	22.1	0.6335
AT5G02910			F-box/RNI-like superfamily pro...		Lus10000727 [exp]	23.2	0.6335
					Lus10039674 [exp]	24.2	0.6335

Compare expression of checked genes

Lus10015374 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.