Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G15290 176 / 2e-56 CASP5 Casparian strip membrane domain protein 5, Uncharacterised protein family (UPF0497) (.1) AT1G14160 143 / 4e-43 Uncharacterised protein family (UPF0497) (.1) AT2G36100 134 / 1e-39 CASP1 Casparian strip membrane domain protein 1, Uncharacterised protein family (UPF0497) (.1) AT2G27370 123 / 3e-35 CASP3 Casparian strip membrane domain protein 3, Uncharacterised protein family (UPF0497) (.1) AT5G06200 120 / 1e-34 CASP4 Casparian strip membrane domain protein 4, Uncharacterised protein family (UPF0497) (.1) AT3G11550 117 / 5e-33 CASP2 Casparian strip membrane domain protein 2, Uncharacterised protein family (UPF0497) (.1) AT1G03700 64 / 6e-13 Uncharacterised protein family (UPF0497) (.1) AT5G44550 62 / 4e-12 Uncharacterised protein family (UPF0497) (.1) AT4G03540 59 / 4e-11 Uncharacterised protein family (UPF0497) (.1) AT3G06390 58 / 1e-10 Uncharacterised protein family (UPF0497) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033007 [exp] 283 / 2e-98 AT5G15290 216 / 3e-72 Casparian strip membrane domain protein 5, Uncharacterised protein family (UPF0497) (.1) Lus10037160 [exp] 155 / 4e-48 AT1G14160 214 / 9e-71 Uncharacterised protein family (UPF0497) (.1) Lus10021333 [exp] 135 / 5e-40 AT3G11550 246 / 1e-83 Casparian strip membrane domain protein 2, Uncharacterised protein family (UPF0497) (.1) Lus10029409 [exp] 134 / 1e-39 AT3G11550 234 / 9e-79 Casparian strip membrane domain protein 2, Uncharacterised protein family (UPF0497) (.1) Lus10004205 [exp] 130 / 4e-38 AT3G11550 232 / 8e-78 Casparian strip membrane domain protein 2, Uncharacterised protein family (UPF0497) (.1) Lus10017009 [exp] 133 / 3e-36 AT3G11540 1356 / 0.0 SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10017008 [exp] 107 / 4e-29 AT2G27370 228 / 5e-76 Casparian strip membrane domain protein 3, Uncharacterised protein family (UPF0497) (.1) Lus10021332 [exp] 102 / 3e-27 AT2G36100 229 / 1e-76 Casparian strip membrane domain protein 1, Uncharacterised protein family (UPF0497) (.1) Lus10036770 [exp] 83 / 3e-20 AT1G14160 119 / 2e-34 Uncharacterised protein family (UPF0497) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G032300 [exp] 220 / 9e-74 AT5G15290 207 / 1e-68 Casparian strip membrane domain protein 5, Uncharacterised protein family (UPF0497) (.1) Potri.008G088700 [exp] 154 / 5e-48 AT1G14160 163 / 3e-51 Uncharacterised protein family (UPF0497) (.1) Potri.009G160000 [exp] 117 / 6e-33 AT2G27370 146 / 2e-43 Casparian strip membrane domain protein 3, Uncharacterised protein family (UPF0497) (.1) Potri.016G075400 [exp] 115 / 3e-32 AT5G06200 179 / 2e-57 Casparian strip membrane domain protein 4, Uncharacterised protein family (UPF0497) (.1) Potri.006G208800 [exp] 114 / 8e-32 AT5G06200 201 / 7e-66 Casparian strip membrane domain protein 4, Uncharacterised protein family (UPF0497) (.1) Potri.016G075300 [exp] 107 / 2e-29 AT5G06200 162 / 2e-50 Casparian strip membrane domain protein 4, Uncharacterised protein family (UPF0497) (.1) Potri.013G131700 [exp] 64 / 9e-13 AT1G03700 159 / 9e-50 Uncharacterised protein family (UPF0497) (.1) Potri.019G100300 [exp] 61 / 9e-12 AT1G03700 150 / 6e-47 Uncharacterised protein family (UPF0497) (.1) Potri.004G043300 [exp] 53 / 6e-09 AT4G03540 103 / 2e-28 Uncharacterised protein family (UPF0497) (.1) Potri.001G442300 [exp] 45 / 4e-06 AT5G44550 173 / 4e-55 Uncharacterised protein family (UPF0497) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0396 [flax] [poplar] Marvel-like PF04535 [flax] [poplar] DUF588 Domain of unknown function (DUF588)
Representative CDS sequence Show only first row Show all	>Lus10015375 pacid=23160916 polypeptide=Lus10015375 locus=Lus10015375.g ID=Lus10015375.BGIv1.0 annot-version=v1.0 ATGGCAGTTGGTGCAGTTGAACTTGGTGAGGCAAAGGGGTTTTCAACCTCAAAGTCTGGCGTGAAAAGAGGGGTTGCCTCCCTAGACTTCATTTTGCGCC TAGTTGGCTTCATTGGTACACTCGGGAGTGCTATTATGATGGCCACAACTAACGAAACACTTCCTTTCGTCACTCAATTCATCCGCTTCAGAGCTGAATA CAACGATCTTCCAACATTCACGTTTTTTGTGGTTGCCAATGGTGTCGTCAGCGCCTATCTGCTTCTATCACTCCCACTTTCAATCTTCCACATTCTGAGG AGCACTGCAAGGAACAGTAGAGTCGTCCTTCTAATATTTGACACGGCGGCACTGGCTTTATTAACAGCCGGATCTTCAGCTGCTGCTGCTATAGTGTACT TGGCACATAAAGGGAACAACAAGGCAAACTGGCTTGCCATCTGCCAGCAGTTCAACTCCTTCTGCGAGCGCATCTCGGGGTCCTTGATTGGATCTTATGT GGGAGTGACTGTCTTCATATTGCTCATACTGCTCTCCGCTTCAGCCCTTTCCCGCTCCTGA
AA sequence Show only first row Show all	>Lus10015375 pacid=23160916 polypeptide=Lus10015375 locus=Lus10015375.g ID=Lus10015375.BGIv1.0 annot-version=v1.0 MAVGAVELGEAKGFSTSKSGVKRGVASLDFILRLVGFIGTLGSAIMMATTNETLPFVTQFIRFRAEYNDLPTFTFFVVANGVVSAYLLLSLPLSIFHILR STARNSRVVLLIFDTAALALLTAGSSAAAAIVYLAHKGNNKANWLAICQQFNSFCERISGSLIGSYVGVTVFILLILLSASALSRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G15290		CASP5	Casparian strip membrane domai...		Lus10015375 [exp]	0	1
AT3G11550		CASP2	Casparian strip membrane domai...		Lus10004205 [exp]	1.7	0.9496
AT1G03220			Eukaryotic aspartyl protease f...		Lus10021938 [exp]	1.7	0.9355
AT5G15290		CASP5	Casparian strip membrane domai...		Lus10033007 [exp]	2.0	0.9321
AT2G32300		UCC1	uclacyanin 1 (.1)		Lus10027143 [exp]	2.2	0.9229
AT2G36100		CASP1	Casparian strip membrane domai...		Lus10021332 [exp]	3.5	0.9359
AT3G57040		ATRR4, ARR9	RESPONSE REGULATOR 4, response...		Lus10039524 [exp]	5.1	0.8952
AT1G79910			Regulator of Vps4 activity in ...		Lus10011455 [exp]	5.7	0.8962
AT1G19230			Riboflavin synthase-like super...		Lus10034890 [exp]	6.3	0.9037
AT3G63520		ATNCED1, ATCCD1...	carotenoid cleavage dioxygenas...		Lus10009513 [exp]	6.9	0.8953
AT3G50150			Plant protein of unknown funct...		Lus10010065 [exp]	8.4	0.8992

Compare expression of checked genes

Lus10015375 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.