Lus10015380 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G39210 130 / 2e-39 CRR7 chlororespiratory reduction 7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032982 137 / 1e-42 AT5G39210 101 / 1e-28 chlororespiratory reduction 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G120300 133 / 2e-40 AT5G39210 132 / 6e-40 chlororespiratory reduction 7 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF12095 CRR7 Protein CHLORORESPIRATORY REDUCTION 7
Representative CDS sequence
>Lus10015380 pacid=23160955 polypeptide=Lus10015380 locus=Lus10015380.g ID=Lus10015380.BGIv1.0 annot-version=v1.0
ATGTTGAGAGGAGCTTCATCTTCAACCAATGCGGCGCTTTCAGCGGGGAAAGCCTTTGGGAACCAAGGTAGTAGCCGAGGTTCTGCTGCCTGGCATAATT
GCTGCGTATCTCCACAAATATTAACTCATAATACTTCACCACCAACACTTCATTCTTCACCATCTGTTCCAAGATTAGTACTAAAGGTTTGGGCGACAAG
AAGGAGGAGACAGGAGAGGTCGGACACATATGTGCTGCTGGAGCCAGGAAAGGATGAAACATTTGTTAGCGAGGAGGAACTGAAAGTGAGACTGAAGAGT
TACTTGGAGAATTGGCCCACAAAGACCTTACCACCGGACCTTGCTAGATTTGAGGAGATGGAGGATGCTGTCGCTTTCTTGCTGGCTTCTGCTTGCGAGC
TGGAAATTGATGGCGATGTTGGTTCTCTTCAATGGTATCAAGTTCGTTTGGATTGA
AA sequence
>Lus10015380 pacid=23160955 polypeptide=Lus10015380 locus=Lus10015380.g ID=Lus10015380.BGIv1.0 annot-version=v1.0
MLRGASSSTNAALSAGKAFGNQGSSRGSAAWHNCCVSPQILTHNTSPPTLHSSPSVPRLVLKVWATRRRRQERSDTYVLLEPGKDETFVSEEELKVRLKS
YLENWPTKTLPPDLARFEEMEDAVAFLLASACELEIDGDVGSLQWYQVRLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G39210 CRR7 chlororespiratory reduction 7 ... Lus10015380 0 1
AT5G30510 ARRPS1, RPS1 ribosomal protein S1 (.1) Lus10017100 2.2 0.9651
AT3G06670 binding (.1.2) Lus10021547 3.9 0.9539
AT1G45474 LHCA5 photosystem I light harvesting... Lus10042657 5.9 0.9475
AT5G19220 ADG2, APL1 ADP GLUCOSE PYROPHOSPHORYLASE ... Lus10034053 6.0 0.9487
AT3G60370 FKBP-like peptidyl-prolyl cis-... Lus10042897 7.7 0.9561
AT1G07080 Thioredoxin superfamily protei... Lus10012503 8.0 0.9458
Lus10030090 8.5 0.9404
AT5G40950 RPL27 ribosomal protein large subuni... Lus10012538 9.8 0.9526
AT5G45680 ATFKBP13 FK506 BINDING PROTEIN 13, FK50... Lus10006949 12.2 0.9521
AT5G14660 DEF2, PDF1B, AT... peptide deformylase 1B (.1.2) Lus10022255 12.6 0.9428

Lus10015380 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.