Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G02120 57 / 2e-11 hydroxyproline-rich glycoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032981 [exp] 130 / 4e-40 AT3G02120 57 / 2e-11 hydroxyproline-rich glycoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G094200 [exp] 64 / 3e-14 AT3G02120 87 / 3e-23 hydroxyproline-rich glycoprotein family protein (.1) Potri.004G120200 [exp] 63 / 1e-13 AT3G02120 79 / 2e-19 hydroxyproline-rich glycoprotein family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015381 pacid=23160932 polypeptide=Lus10015381 locus=Lus10015381.g ID=Lus10015381.BGIv1.0 annot-version=v1.0 ATGGAAGAGGAGAAGCAGCAAATCAGTGAATCCAACAAAGCAGAAGAAGTATTGGTTGTTTCTCCTGAGAAGATGATGAGAGTTTCGTCCCCCCGCAGAG ATGAAGATTCTAGCAAGAGCAGCAGCAGCAGCAGCGCAATCCCACTTGTCCCTCTCCAAGTTCCCAAGGCATTTAACTACCCTGAAAGGTACAAGAGCCC CACTGATACCATGGTTTCTCCAATCACCAAAGGCATTCTTGCTAGGAAAAGAAGGCCGATTGGTGCTGCTGCTGGAGGAGGAGAAGCTCTTCCGTTGCCG CCGATCAACCCCACTACTCTGTTCCAAGGTGTGGACTCAACTCCATCCATTAATCTTGAATCAAGTTGA
AA sequence Show only first row Show all	>Lus10015381 pacid=23160932 polypeptide=Lus10015381 locus=Lus10015381.g ID=Lus10015381.BGIv1.0 annot-version=v1.0 MEEEKQQISESNKAEEVLVVSPEKMMRVSSPRRDEDSSKSSSSSSAIPLVPLQVPKAFNYPERYKSPTDTMVSPITKGILARKRRPIGAAAGGGEALPLP PINPTTLFQGVDSTPSINLESS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G02120			hydroxyproline-rich glycoprote...		Lus10015381 [exp]	0	1
AT2G28105			unknown protein		Lus10021424 [exp]	1.0	0.8597
AT2G02470	Alfin	AL6	alfin-like 6 (.1.2)		Lus10042404 [exp]	2.0	0.8428
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10032561 [exp]	3.9	0.8280
AT4G22320			unknown protein		Lus10032566 [exp]	4.2	0.8395
AT4G40045			unknown protein		Lus10034155 [exp]	4.2	0.8110
AT5G27690			Heavy metal transport/detoxifi...		Lus10015174 [exp]	4.5	0.8322
					Lus10016269 [exp]	8.5	0.8177
AT4G02590	bHLH	bHLH059, UNE12	unfertilized embryo sac 12, ba...		Lus10014726 [exp]	10.8	0.7728
AT5G41010		NRPE12, NRPD12,...	DNA directed RNA polymerase, 7...		Lus10007891 [exp]	15.0	0.7869
AT3G24730			mRNA splicing factor, thioredo...		Lus10011878 [exp]	15.4	0.6895

Compare expression of checked genes

Lus10015381 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.