Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14650 106 / 1e-27 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2) AT1G14640 73 / 4e-16 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1) AT4G16200 67 / 3e-14 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1) AT5G06520 64 / 8e-13 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1) AT5G55100 55 / 9e-10 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.2) AT1G18050 48 / 2e-07 SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.1) AT3G27600 38 / 0.0007 SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.1) AT3G52120 38 / 0.001 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025704 [exp] 182 / 2e-58 AT1G14650 346 / 4e-114 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2) Lus10035958 [exp] 179 / 2e-53 AT1G14650 886 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2) Lus10013966 [exp] 157 / 6e-46 AT1G14650 672 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2) Lus10007278 [exp] 59 / 6e-11 AT1G14650 512 / 3e-174 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2) Lus10043105 [exp] 49 / 1e-07 AT5G55100 504 / 1e-165 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.2) Lus10032646 [exp] 45 / 3e-06 AT5G55100 499 / 3e-164 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.2) Lus10015703 [exp] 44 / 1e-05 AT3G52120 477 / 2e-166 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G070700 [exp] 137 / 1e-38 AT1G14650 810 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2) Potri.005G094600 [exp] 130 / 3e-36 AT1G14650 814 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2) Potri.001G356800 [exp] 52 / 9e-09 AT5G55100 420 / 6e-133 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.2) Potri.001G269900 [exp] 47 / 8e-07 AT3G52120 500 / 3e-176 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.2) Potri.009G064600 [exp] 46 / 1e-06 AT3G52120 509 / 1e-179 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.2) Potri.006G279800 [exp] 39 / 0.0005 AT4G31200 579 / 0.0 SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.2), SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01805 [flax] [poplar] Surp Surp module
Representative CDS sequence Show only first row Show all	>Lus10015391 pacid=23160864 polypeptide=Lus10015391 locus=Lus10015391.g ID=Lus10015391.BGIv1.0 annot-version=v1.0 ATGCCAGGCACAGCAATTCTGACTCTGCAAGCACCTCCTCCTCACTCAGAAGGGTATCCTCCTCCCTCATCCCAACTGTCAGAACATAATTCAAATGAAG AAAACCCAGTGAATGAGGATCATAATAGAGCTCAGGTTGCTACCCACACCAGAACCATTAGAATTATTCATCCTCCTCCAGGTATCCGGAATATTGTTGA CAAAACCGCACAGTTTGTTGCCAAAAAGGGACCCGAGTTTGAGAAAACGATTATGGATCGTACTGTCAAAAATGATAACTTCAAGTTTTTGAATCCCAAC GATCCGTATCATGCGTATTATCAACATCGTTTATCCGAGTCTCGCACCCAGAATCCCTCTTCTAAACAATAG
AA sequence Show only first row Show all	>Lus10015391 pacid=23160864 polypeptide=Lus10015391 locus=Lus10015391.g ID=Lus10015391.BGIv1.0 annot-version=v1.0 MPGTAILTLQAPPPHSEGYPPPSSQLSEHNSNEENPVNEDHNRAQVATHTRTIRIIHPPPGIRNIVDKTAQFVAKKGPEFEKTIMDRTVKNDNFKFLNPN DPYHAYYQHRLSESRTQNPSSKQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G14650			SWAP (Suppressor-of-White-APri...		Lus10015391 [exp]	0	1
AT1G71050		HIPP20	heavy metal associated isopren...		Lus10042946 [exp]	13.3	0.6160
AT3G12620			Protein phosphatase 2C family ...		Lus10003993 [exp]	17.3	0.6136
AT5G18190			Protein kinase family protein ...		Lus10043244 [exp]	21.4	0.5984
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039501 [exp]	21.8	0.6063
					Lus10015218 [exp]	31.2	0.5938
AT2G39080		EMB2799	EMBRYO DEFECTIVE 2799, NAD(P)-...		Lus10037911 [exp]	33.3	0.5899
					Lus10009632 [exp]	35.4	0.5895
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039502 [exp]	36.6	0.5914
					Lus10010383 [exp]	36.8	0.5895
AT4G11530		CRK34	cysteine-rich RLK (RECEPTOR-li...		Lus10022285 [exp]	38.3	0.5895

Compare expression of checked genes

Lus10015391 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.