Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013980 [exp] 113 / 4e-34 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015401 pacid=23160903 polypeptide=Lus10015401 locus=Lus10015401.g ID=Lus10015401.BGIv1.0 annot-version=v1.0 ATGTTTCGTGATAGCAAAGTGTCCCATGACGGTCATGATCCTGATATCCGGCCAGCGAAGAAACGCAAAAGCGATGAACCGAGACTTGTCAAGAACGACG AGAACCAAGTTTCGAGACGCAAGAATGAGGAACATAAGAGGAAGAAAGAGGCATTACAGAGACGAGACCGAGACCGTGAATCGAGAAAGGAGAAGGATAG ATATGTGCATGAAAGGAAGCAGCTTGATGAGGAAAGGACGTTTCAGAAAGAGTATCTAATGGCATGTAACTTATCCGAGTGCTGA
AA sequence Show only first row Show all	>Lus10015401 pacid=23160903 polypeptide=Lus10015401 locus=Lus10015401.g ID=Lus10015401.BGIv1.0 annot-version=v1.0 MFRDSKVSHDGHDPDIRPAKKRKSDEPRLVKNDENQVSRRKNEEHKRKKEALQRRDRDRESRKEKDRYVHERKQLDEERTFQKEYLMACNLSEC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10015401 [exp]	0	1
AT2G37480			unknown protein		Lus10023755 [exp]	2.0	0.9288
AT4G28400			Protein phosphatase 2C family ...		Lus10018618 [exp]	2.8	0.9248
AT3G61710		AtBECLIN1, ATAT...	BECLIN1, AUTOPHAGY 6 (.1.2.3)		Lus10012632 [exp]	6.0	0.9145
AT5G01750			Protein of unknown function (D...		Lus10002477 [exp]	7.7	0.8846
AT3G21610			Acid phosphatase/vanadium-depe...		Lus10030025 [exp]	10.8	0.8716
AT4G25770			alpha/beta-Hydrolases superfam...		Lus10001320 [exp]	11.1	0.9111
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Lus10042857 [exp]	13.8	0.9035
AT2G46950		CYP709B2	"cytochrome P450, family 709, ...		Lus10025756 [exp]	13.9	0.9014
AT2G33580			Protein kinase superfamily pro...		Lus10039406 [exp]	14.9	0.8393
AT4G27880			Protein with RING/U-box and TR...		Lus10022405 [exp]	16.7	0.8920

Compare expression of checked genes

Lus10015401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.