Lus10015405 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040835 139 / 3e-42 ND 38 / 0.002
Lus10013984 114 / 3e-31 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10015405 pacid=23160914 polypeptide=Lus10015405 locus=Lus10015405.g ID=Lus10015405.BGIv1.0 annot-version=v1.0
ATGGAATTCGATCATGTTTCCGAGGTTGAAGAGAAGGGTAATTACTGCTTACTCCATGATGCAATAGTAAGCAGCAAACTCAATGAATTGGGGGAAGATA
TCTTGATAGAGATTCTATCTCGATCTCCTGTAAAAACTCTGTTGAAGCTCAAAGATTCGGTTGCTTTACTTGATCTGCCAGTTGGGAATCCTGCAGTGAA
GTTTGATATGTGGGTTCTGGACGAAGAACAATGGTGTTGGGTCAAACAATCCACCGTTGTTCATTTGGAATATCATGAAATGGTGTTTGGAGATTTGACA
GAAGGTAAGCTTGTGGTGTATGACCGCCATAGACATGCGTTGAGGTTGTTCGACCCTGCAACTAAACCCACTAAAACTTTACTTCAAAGTTGTGACTATG
GCTTCCTTGATGATGGCGTGTTCGTCTACAAAGATAGCTTGGTGTCTGGGTGA
AA sequence
>Lus10015405 pacid=23160914 polypeptide=Lus10015405 locus=Lus10015405.g ID=Lus10015405.BGIv1.0 annot-version=v1.0
MEFDHVSEVEEKGNYCLLHDAIVSSKLNELGEDILIEILSRSPVKTLLKLKDSVALLDLPVGNPAVKFDMWVLDEEQWCWVKQSTVVHLEYHEMVFGDLT
EGKLVVYDRHRHALRLFDPATKPTKTLLQSCDYGFLDDGVFVYKDSLVSG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10015405 0 1
AT5G52975 Protein of unknown function (D... Lus10001307 1.0 0.7495
AT2G38290 AMT2;1, ATAMT2 AMMONIUM TRANSPORTER 2;1, ammo... Lus10014713 6.9 0.6632
AT2G18470 AtPERK4, PERK4 proline-rich extensin-like rec... Lus10026027 13.6 0.6198
AT2G45960 PIP1;2, ATHH2, ... TRANSMEMBRANE PROTEIN A, NAMED... Lus10007568 23.2 0.6295
AT5G16100 unknown protein Lus10020810 49.6 0.5557
AT1G04380 2-oxoglutarate (2OG) and Fe(II... Lus10009240 73.5 0.5761
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Lus10024816 107.1 0.5288
AT1G03620 ELMO/CED-12 family protein (.1... Lus10018574 117.0 0.5156
AT1G72590 3-oxo-5-alpha-steroid 4-dehydr... Lus10018059 123.8 0.5607
AT1G04110 SDD1 STOMATAL DENSITY AND DISTRIBUT... Lus10029577 133.4 0.5166

Lus10015405 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.