Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G047866 [exp] 53 / 1e-11 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015413 pacid=23160847 polypeptide=Lus10015413 locus=Lus10015413.g ID=Lus10015413.BGIv1.0 annot-version=v1.0 ATGGAGCTGTTCGTACTGGGTTGCACGGGAGTTGTGGTGTTCCTTCACGGAGCTAATTTCTTCTTCCACGCTCTCTGCCACCACCTAGCCATCTTCCGTT CTGTCAGAATTGTACAGTTTTTCAAGGTTTTGGATCTTATGAGCAAGAAAGAGGTATTAGCAGTACCATTTAGCAACAGAGAAGTTATGTATTAG
AA sequence Show only first row Show all	>Lus10015413 pacid=23160847 polypeptide=Lus10015413 locus=Lus10015413.g ID=Lus10015413.BGIv1.0 annot-version=v1.0 MELFVLGCTGVVVFLHGANFFFHALCHHLAIFRSVRIVQFFKVLDLMSKKEVLAVPFSNREVMY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10015413 [exp]	0	1
AT1G11380			PLAC8 family protein (.1)		Lus10018410 [exp]	3.2	0.9789
AT3G26100			Regulator of chromosome conden...		Lus10036945 [exp]	3.9	0.9713
AT5G65030			unknown protein		Lus10026049 [exp]	4.0	0.9682
AT2G20690			lumazine-binding family protei...		Lus10039826 [exp]	5.2	0.9558
AT5G41810			unknown protein		Lus10003901 [exp]	5.8	0.9746
AT1G11260		ATSTP1, STP1	sugar transporter 1 (.1)		Lus10042516 [exp]	6.0	0.9741
AT1G12110		CHL1-1, CHL1, B...	CHLORINA 1, ARABIDOPSIS THALIA...		Lus10024614 [exp]	6.3	0.9596
AT1G14160			Uncharacterised protein family...		Lus10037160 [exp]	8.0	0.9722
AT1G10070		ATBCAT-2	branched-chain amino acid tran...		Lus10007247 [exp]	11.2	0.9711
AT1G70840		MLP31	MLP-like protein 31 (.1)		Lus10020497 [exp]	11.5	0.9645

Compare expression of checked genes

Lus10015413 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.