Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53940 169 / 2e-55 Yippee family putative zinc-binding protein (.1) AT2G40110 147 / 9e-47 Yippee family putative zinc-binding protein (.1.2) AT3G08990 144 / 1e-45 Yippee family putative zinc-binding protein (.1.2) AT3G55890 134 / 7e-42 Yippee family putative zinc-binding protein (.1) AT3G11230 133 / 3e-41 Yippee family putative zinc-binding protein (.1.2) AT4G27745 101 / 5e-29 Yippee family putative zinc-binding protein (.1) AT4G27740 99 / 5e-28 Yippee family putative zinc-binding protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013992 [exp] 212 / 2e-72 AT5G53940 157 / 1e-50 Yippee family putative zinc-binding protein (.1) Lus10028300 [exp] 147 / 7e-47 AT2G40110 228 / 8e-79 Yippee family putative zinc-binding protein (.1.2) Lus10040190 [exp] 146 / 3e-46 AT2G40110 228 / 1e-78 Yippee family putative zinc-binding protein (.1.2) Lus10035531 [exp] 135 / 6e-42 AT3G08990 174 / 2e-57 Yippee family putative zinc-binding protein (.1.2) Lus10027762 [exp] 135 / 6e-42 AT2G40110 173 / 4e-57 Yippee family putative zinc-binding protein (.1.2) Lus10007773 [exp] 107 / 3e-31 AT4G27745 186 / 7e-63 Yippee family putative zinc-binding protein (.1) Lus10000335 [exp] 107 / 3e-31 AT4G27745 195 / 2e-66 Yippee family putative zinc-binding protein (.1) Lus10033226 [exp] 107 / 4e-31 AT4G27745 194 / 6e-66 Yippee family putative zinc-binding protein (.1) Lus10023244 [exp] 100 / 3e-28 AT4G27740 124 / 2e-38 Yippee family putative zinc-binding protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G115700 [exp] 168 / 5e-55 AT5G53940 187 / 1e-62 Yippee family putative zinc-binding protein (.1) Potri.010G190000 [exp] 145 / 7e-46 AT2G40110 224 / 6e-77 Yippee family putative zinc-binding protein (.1.2) Potri.008G067100 [exp] 145 / 2e-45 AT2G40110 232 / 1e-79 Yippee family putative zinc-binding protein (.1.2) Potri.016G115000 [exp] 132 / 1e-40 AT3G11230 154 / 2e-49 Yippee family putative zinc-binding protein (.1.2) Potri.001G085400 [exp] 108 / 1e-31 AT4G27745 197 / 3e-67 Yippee family putative zinc-binding protein (.1) Potri.006G015500 [exp] 107 / 5e-31 AT3G08990 122 / 6e-37 Yippee family putative zinc-binding protein (.1.2) Potri.014G101600 [exp] 103 / 9e-30 AT4G27745 154 / 2e-50 Yippee family putative zinc-binding protein (.1) Potri.015G009200 [exp] 103 / 1e-29 AT4G27745 201 / 1e-68 Yippee family putative zinc-binding protein (.1) Potri.012G019100 [exp] 103 / 1e-29 AT4G27745 202 / 2e-69 Yippee family putative zinc-binding protein (.1) Potri.015G009100 [exp] 103 / 1e-29 AT4G27740 131 / 4e-41 Yippee family putative zinc-binding protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0080 [flax] [poplar] Beta-tent PF03226 [flax] [poplar] Yippee-Mis18 Yippee zinc-binding/DNA-binding /Mis18, centromere assembly
Representative CDS sequence Show only first row Show all	>Lus10015416 pacid=23160911 polypeptide=Lus10015416 locus=Lus10015416.g ID=Lus10015416.BGIv1.0 annot-version=v1.0 ATGGGAAGAGTGTTTGTGGTGGAATTGGACGGCAGGTGTTACCGATGCAGGTTCTGCAACACGCCTCTCGCCCTCGCCGACGATGTAATCTCCCGGACTT TCAATTGTGGACAAGGGAGGGCGTACTTGTTCAGCAACGTAGTGAATGTAACAGTTGGAATGACAGAGGAAAGGATGATGCTTTCCGGTACTCATACCGT TGAAGATGTGTTCTGCTGCCGATGTGGACAAATTCTCGGCTGGACATATGTAGCTGCGCATGACAAAACCCAGAAGTACAAAGAAGGGAAGTTTGTTCTT GAGAGGTGGAGGATAGCTGAGGAGGTTTCCGACGAACTGAGCCTGGACACTGGTCATGTTAGTTCAAGCGATACGGATAACTAG
AA sequence Show only first row Show all	>Lus10015416 pacid=23160911 polypeptide=Lus10015416 locus=Lus10015416.g ID=Lus10015416.BGIv1.0 annot-version=v1.0 MGRVFVVELDGRCYRCRFCNTPLALADDVISRTFNCGQGRAYLFSNVVNVTVGMTEERMMLSGTHTVEDVFCCRCGQILGWTYVAAHDKTQKYKEGKFVL ERWRIAEEVSDELSLDTGHVSSSDTDN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53940			Yippee family putative zinc-bi...		Lus10015416 [exp]	0	1
AT4G31270	Trihelix		sequence-specific DNA binding ...		Lus10020182 [exp]	3.2	0.8253
AT1G05600		EMB3101	EMBRYO DEFECTIVE 3101, Tetratr...		Lus10002681 [exp]	3.5	0.8227
AT4G00620		EMB3127	EMBRYO DEFECTIVE 3127, Amino a...		Lus10017822 [exp]	6.4	0.8578
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10000920 [exp]	16.6	0.8328
AT4G30360		ATCNGC17	cyclic nucleotide-gated channe...		Lus10023203 [exp]	16.9	0.8436
AT5G44080	bZIP		Basic-leucine zipper (bZIP) tr...		Lus10028575 [exp]	18.5	0.8259
AT1G29850			double-stranded DNA-binding fa...		Lus10004609 [exp]	21.0	0.8066
AT1G27695			glycine-rich protein (.1.2)		Lus10032855 [exp]	22.2	0.8038
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10002264 [exp]	24.0	0.8128
AT1G27000			Protein of unknown function (D...		Lus10037210 [exp]	30.0	0.7977

Compare expression of checked genes

Lus10015416 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.