Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28330 120 / 8e-37 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) AT5G44300 108 / 2e-32 Dormancy/auxin associated family protein (.1) AT2G33830 108 / 2e-32 Dormancy/auxin associated family protein (.1.2) AT1G56220 43 / 2e-06 Dormancy/auxin associated family protein (.1.2.3.4) AT1G54070 40 / 2e-05 Dormancy/auxin associated family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013997 [exp] 196 / 7e-67 AT1G28330 119 / 4e-36 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10013996 [exp] 131 / 2e-41 AT1G28330 74 / 2e-18 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10015318 [exp] 113 / 7e-34 AT1G28330 117 / 2e-35 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10025446 [exp] 87 / 6e-24 AT2G33830 82 / 4e-22 Dormancy/auxin associated family protein (.1.2) Lus10031488 [exp] 43 / 4e-06 AT1G56220 136 / 3e-42 Dormancy/auxin associated family protein (.1.2.3.4) Lus10015193 [exp] 43 / 5e-06 AT1G56220 134 / 3e-41 Dormancy/auxin associated family protein (.1.2.3.4) Lus10020661 [exp] 42 / 5e-06 AT1G56220 126 / 2e-38 Dormancy/auxin associated family protein (.1.2.3.4) Lus10029881 [exp] 42 / 1e-05 AT5G27830 245 / 9e-80 unknown protein Lus10008142 [exp] 41 / 1e-05 AT1G54070 65 / 1e-14 Dormancy/auxin associated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G047100 [exp] 106 / 6e-31 AT1G28330 122 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Potri.001G164800 [exp] 47 / 4e-08 AT1G54070 67 / 3e-15 Dormancy/auxin associated family protein (.1) Potri.013G014900 [exp] 43 / 2e-06 AT1G56220 97 / 7e-27 Dormancy/auxin associated family protein (.1.2.3.4) Potri.005G024250 [exp] 42 / 4e-06 AT1G56220 86 / 2e-23 Dormancy/auxin associated family protein (.1.2.3.4) Potri.003G070500 [exp] 39 / 0.0001 AT1G54070 90 / 6e-24 Dormancy/auxin associated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05564 [flax] [poplar] Auxin_repressed Dormancy/auxin associated protein
Representative CDS sequence Show only first row Show all	>Lus10015418 pacid=23160901 polypeptide=Lus10015418 locus=Lus10015418.g ID=Lus10015418.BGIv1.0 annot-version=v1.0 ATGCTAGAGAAACTGTGGGACGACGTTGTTGCAGGGCCACAGCCGGAGCGTGGCCTCGGCAAGCTCCGGAGGACCAGCGCCAAACCCCTGAACATCGATC ACGGGGAGAAGAAGATGGAGAAGTCGCTGTCCATGCCGGCGAGTCCGTCAACGCCCGGCACACCGAAGGAGAACGTGTGGAGGAGCGTTTTCCATCCGGG GAGTAACCTCGCCACCAGGTCGTTCGGTGCTCATCAGATGTACGACAAGCCTTCTCACCCCAACTCCCCCACCGTCTACGACTGGTAA
AA sequence Show only first row Show all	>Lus10015418 pacid=23160901 polypeptide=Lus10015418 locus=Lus10015418.g ID=Lus10015418.BGIv1.0 annot-version=v1.0 MLEKLWDDVVAGPQPERGLGKLRRTSAKPLNIDHGEKKMEKSLSMPASPSTPGTPKENVWRSVFHPGSNLATRSFGAHQMYDKPSHPNSPTVYDW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G28330		DYL1, DRM1	DORMANCY-ASSOCIATED PROTEIN 1,...		Lus10015418 [exp]	0	1
AT5G18840			Major facilitator superfamily ...		Lus10033995 [exp]	5.3	0.9367
AT2G21660		CCR2, ATGRP7, G...	GLYCINE-RICH RNA-BINDING PROTE...		Lus10042321 [exp]	9.2	0.9033
AT2G35830			unknown protein		Lus10040372 [exp]	9.5	0.9159
AT4G35090		CAT2	catalase 2 (.1.2)		Lus10013225 [exp]	11.8	0.9067
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10018702 [exp]	11.8	0.9327
AT2G39420			alpha/beta-Hydrolases superfam...		Lus10040328 [exp]	13.3	0.9217
AT2G18370			Bifunctional inhibitor/lipid-t...		Lus10038429 [exp]	19.1	0.8991
AT5G51970			GroES-like zinc-binding alcoho...		Lus10031659 [exp]	22.1	0.9326
AT5G58800			Quinone reductase family prote...		Lus10005862 [exp]	22.8	0.9227
AT4G32180		ATPANK2	pantothenate kinase 2 (.1.2.3)		Lus10013019 [exp]	23.3	0.9284

Compare expression of checked genes

Lus10015418 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.