Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G33810 125 / 8e-38 SBP SPL3 squamosa promoter binding protein-like 3 (.1) AT1G53160 119 / 6e-35 SBP SPL4 squamosa promoter binding protein-like 4 (.1.2) AT3G15270 116 / 1e-33 SBP SPL5 squamosa promoter binding protein-like 5 (.1) AT2G42200 115 / 2e-31 SBP SPL9, AtSPL9 squamosa promoter binding protein-like 9 (.1) AT1G69170 115 / 3e-31 SBP SPL6 Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1) AT3G60030 114 / 2e-30 SBP SPL12 squamosa promoter-binding protein-like 12 (.1) AT2G47070 113 / 9e-30 SBP SPL1 squamosa promoter binding protein-like 1 (.1) AT3G57920 110 / 1e-29 SBP SPL15, MSC1 squamosa promoter binding protein-like 15 (.1) AT1G02065 110 / 1e-29 SBP SPL8 squamosa promoter binding protein-like 8 (.1.2) AT1G20980 111 / 3e-29 SBP ATSPL14, SPL1R2, FBR6, SPL14 squamosa promoter binding protein-like 14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013999 [exp] 187 / 7e-62 AT2G33810 128 / 6e-39 squamosa promoter binding protein-like 3 (.1) Lus10018610 [exp] 120 / 1e-34 AT3G15270 127 / 7e-37 squamosa promoter binding protein-like 5 (.1) Lus10039846 [exp] 119 / 3e-34 AT1G53160 129 / 8e-38 squamosa promoter binding protein-like 4 (.1.2) Lus10021034 [exp] 116 / 1e-31 AT2G42200 199 / 2e-60 squamosa promoter binding protein-like 9 (.1) Lus10005548 [exp] 111 / 1e-31 AT3G15270 133 / 1e-39 squamosa promoter binding protein-like 5 (.1) Lus10023818 [exp] 115 / 2e-31 AT2G42200 191 / 3e-57 squamosa promoter binding protein-like 9 (.1) Lus10010071 [exp] 115 / 2e-30 AT2G47070 631 / 0.0 squamosa promoter binding protein-like 1 (.1) Lus10016275 [exp] 111 / 2e-30 AT2G42200 179 / 1e-53 squamosa promoter binding protein-like 9 (.1) Lus10004523 [exp] 114 / 3e-30 AT3G60030 499 / 5e-163 squamosa promoter-binding protein-like 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G046700 [exp] 132 / 4e-40 AT1G53160 135 / 4e-41 squamosa promoter binding protein-like 4 (.1.2) Potri.011G055900 [exp] 131 / 4e-40 AT2G33810 129 / 2e-39 squamosa promoter binding protein-like 3 (.1) Potri.001G398200 [exp] 127 / 7e-38 AT1G53160 162 / 6e-51 squamosa promoter binding protein-like 4 (.1.2) Potri.011G116800 [exp] 126 / 9e-37 AT3G15270 159 / 5e-49 squamosa promoter binding protein-like 5 (.1) Potri.007G138800 [exp] 120 / 4e-35 AT3G15270 140 / 4e-42 squamosa promoter binding protein-like 5 (.1) Potri.014G057800 [exp] 117 / 6e-32 AT1G27370 137 / 3e-36 squamosa promoter binding protein-like 10 (.1.2.3.4) Potri.016G048500 [exp] 115 / 1e-31 AT2G42200 217 / 3e-67 squamosa promoter binding protein-like 9 (.1) Potri.014G057700 [exp] 112 / 1e-30 AT1G02065 247 / 3e-80 squamosa promoter binding protein-like 8 (.1.2) Potri.002G142200 [exp] 112 / 2e-30 AT1G02065 243 / 8e-79 squamosa promoter binding protein-like 8 (.1.2) Potri.015G060400 [exp] 114 / 3e-30 AT1G69170 153 / 4e-41 Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03110 [flax] [poplar] SBP SBP domain
Representative CDS sequence Show only first row Show all	>Lus10015421 pacid=23160924 polypeptide=Lus10015421 locus=Lus10015421.g ID=Lus10015421.BGIv1.0 annot-version=v1.0 ATGGCCAGAGTTGAAGGAGGAAAGAGGACCCTAAAGGAGATCGAAGAAGACGATGAGGACCAGGACGAGCTTCTCGACGAAGTCTTGGGGTTCGATGTCG ACAAAAAGACTAAGAAGGGCAAGCGAGTCGTTGTAGGGTCCACGTCATCATGGTCTTCTTCCGGTGGAGGGGTGGCCGCGGTTAGCTGTCAGGCGGAGAA TTGCAGCTCCGACATGGCCGGAGCTAGGAGGTACTACAAGAGGCATAAGGTTTGTGAGGTCCACGCTAGGGCTCCTGTGGTTCTTGTTGCTGGTGTTCAT CAGAGGTTCTGCCAGCAATGCAGCAGGTTCCACGAGTTGTCGGAGTTCGACGACACCAAGAAGAGCTGCCGGCGGCGCCTGGCCGGACACAACGAACGTC GGCGGAAAAGCTCATCTGAAGGACCCAATTGA
AA sequence Show only first row Show all	>Lus10015421 pacid=23160924 polypeptide=Lus10015421 locus=Lus10015421.g ID=Lus10015421.BGIv1.0 annot-version=v1.0 MARVEGGKRTLKEIEEDDEDQDELLDEVLGFDVDKKTKKGKRVVVGSTSSWSSSGGGVAAVSCQAENCSSDMAGARRYYKRHKVCEVHARAPVVLVAGVH QRFCQQCSRFHELSEFDDTKKSCRRRLAGHNERRRKSSSEGPN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G33810	SBP	SPL3	squamosa promoter binding prot...		Lus10015421 [exp]	0	1
AT3G01470	HD	HD-ZIP-1, HAT5,...	HOMEODOMAIN PROTEIN FROM ARABI...		Lus10036674 [exp]	1.7	0.9240
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10025412 [exp]	3.0	0.9075
AT3G43660			Vacuolar iron transporter (VIT...		Lus10025685 [exp]	3.2	0.9215
AT2G42610		LSH10	LIGHT SENSITIVE HYPOCOTYLS 10,...		Lus10020700 [exp]	3.7	0.8859
					Lus10040690 [exp]	4.5	0.8954
AT2G02130		PDF2.3, LCR68	low-molecular-weight cysteine-...		Lus10019227 [exp]	5.1	0.8770
AT1G75540	CO	LHUS, AtBBX21, ...	long hypocotyl under shade, B-...		Lus10028791 [exp]	5.7	0.8971
AT1G27040			Major facilitator superfamily ...		Lus10002793 [exp]	6.9	0.8950
AT5G27600		LACS7, ATLACS7	long-chain acyl-CoA synthetase...		Lus10010530 [exp]	8.8	0.8809
AT4G37770		ACS8	1-amino-cyclopropane-1-carboxy...		Lus10011565 [exp]	10.4	0.8773

Compare expression of checked genes

Lus10015421 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.