Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G03230 95 / 2e-24 S-locus lectin protein kinase family protein (.1) AT1G67520 94 / 5e-24 lectin protein kinase family protein (.1) AT1G61390 92 / 2e-23 S-locus lectin protein kinase family protein (.1.2) AT4G23190 92 / 3e-23 AT-RLK3, CRK11 RECEPTOR LIKE PROTEIN KINASE 3, cysteine-rich RLK (RECEPTOR-like protein kinase) 11 (.1) AT1G11280 92 / 3e-23 S-locus lectin protein kinase family protein (.1.2.3.4) AT1G61370 92 / 3e-23 S-locus lectin protein kinase family protein (.1) AT1G61550 91 / 3e-23 S-locus lectin protein kinase family protein (.1) AT4G27300 91 / 4e-23 S-locus lectin protein kinase family protein (.1) AT4G11900 91 / 6e-23 S-locus lectin protein kinase family protein (.1) AT3G16030 91 / 8e-23 CES101 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031602 [exp] 126 / 9e-37 AT4G03230 338 / 7e-108 S-locus lectin protein kinase family protein (.1) Lus10033742 [exp] 127 / 3e-36 AT4G03230 161 / 2e-42 S-locus lectin protein kinase family protein (.1) Lus10033743 [exp] 124 / 1e-34 AT4G21380 608 / 0.0 receptor kinase 3 (.1) Lus10031603 [exp] 123 / 2e-34 AT4G03230 558 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10025891 [exp] 122 / 8e-34 AT4G21380 593 / 0.0 receptor kinase 3 (.1) Lus10033741 [exp] 120 / 2e-33 AT4G21380 576 / 0.0 receptor kinase 3 (.1) Lus10018516 [exp] 118 / 2e-32 AT1G11300 699 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10039731 [exp] 118 / 2e-32 AT1G11300 1112 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10028782 [exp] 113 / 8e-31 AT4G21380 649 / 0.0 receptor kinase 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G037300 [exp] 100 / 2e-26 AT4G21390 922 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G120000 [exp] 100 / 3e-26 AT4G03230 967 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G119900 [exp] 97 / 4e-25 AT4G03230 974 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G119700 [exp] 97 / 5e-25 AT4G03230 1025 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.013G150900 [exp] 97 / 5e-25 AT4G21390 635 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G119600 [exp] 96 / 6e-25 AT4G03230 983 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G037600 [exp] 96 / 8e-25 AT4G21390 899 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G039100 [exp] 96 / 1e-24 AT1G11330 859 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.004G027400 [exp] 94 / 4e-24 AT1G11330 872 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.004G027800 [exp] 94 / 4e-24 AT4G21390 941 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10015423 pacid=23160892 polypeptide=Lus10015423 locus=Lus10015423.g ID=Lus10015423.BGIv1.0 annot-version=v1.0 ATGGTCAGGCATGTGAATCGCTTTAAAGATGTATTGGCTGCTACTGATAACTTCTCTGAATTGAACAAGTTGGGAGAGGGTGGGTTTGGCCCTGTTTACA AGGGCAAGTTGAGTGGTGATCAAGAAGTTGCAATGAAGAGACTTTCCAAGAAATCAGGCCAAGGCTTAAAAGAATTTATGAATGAATTGAAGCTCATAGC CAAGCTGCAACATCTATTTGGTCAGGCTGTTGGGGTGCTGCGTTGA
AA sequence Show only first row Show all	>Lus10015423 pacid=23160892 polypeptide=Lus10015423 locus=Lus10015423.g ID=Lus10015423.BGIv1.0 annot-version=v1.0 MVRHVNRFKDVLAATDNFSELNKLGEGGFGPVYKGKLSGDQEVAMKRLSKKSGQGLKEFMNELKLIAKLQHLFGQAVGVLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G00960			Protein kinase superfamily pro...		Lus10015423 [exp]	0	1
AT1G11340			S-locus lectin protein kinase ...		Lus10015424 [exp]	1.4	0.8820
AT5G44090			Calcium-binding EF-hand family...		Lus10003628 [exp]	5.6	0.8831
AT2G44880			Pentatricopeptide repeat (PPR-...		Lus10026886 [exp]	7.0	0.8098
AT4G32700		TEB	TEBICHI, helicases;ATP-depende...		Lus10007673 [exp]	7.1	0.8506
AT5G54520			Transducin/WD40 repeat-like su...		Lus10014805 [exp]	10.5	0.8481
AT5G12040			Nitrilase/cyanide hydratase an...		Lus10025012 [exp]	10.8	0.8777
AT1G78760			F-box/RNI-like superfamily pro...		Lus10024701 [exp]	13.2	0.8328
AT4G16580			Protein phosphatase 2C family ...		Lus10016309 [exp]	13.5	0.8464
					Lus10015568 [exp]	15.9	0.7730
AT5G42920		AtTHO5	THO complex, subunit 5 (.1.2)		Lus10006490 [exp]	16.1	0.8651

Compare expression of checked genes

Lus10015423 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.