Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11340 63 / 4e-12 S-locus lectin protein kinase family protein (.1) AT2G19130 60 / 4e-11 S-locus lectin protein kinase family protein (.1) AT1G11300 59 / 8e-11 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) AT1G11410 59 / 9e-11 S-locus lectin protein kinase family protein (.1) AT3G12000 59 / 1e-10 S-locus related protein SLR1, putative (S1) (.1) AT4G27290 58 / 2e-10 S-locus lectin protein kinase family protein (.1) AT4G21380 53 / 1e-08 ARK3 receptor kinase 3 (.1) AT1G61480 52 / 1e-08 S-locus lectin protein kinase family protein (.1) AT1G61370 52 / 3e-08 S-locus lectin protein kinase family protein (.1) AT1G65790 52 / 3e-08 ARK1 receptor kinase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031603 [exp] 123 / 4e-33 AT4G03230 558 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10033741 [exp] 117 / 4e-31 AT4G21380 576 / 0.0 receptor kinase 3 (.1) Lus10033743 [exp] 114 / 6e-30 AT4G21380 608 / 0.0 receptor kinase 3 (.1) Lus10025891 [exp] 91 / 8e-22 AT4G21380 593 / 0.0 receptor kinase 3 (.1) Lus10031605 [exp] 78 / 5e-19 AT1G61390 70 / 1e-14 S-locus lectin protein kinase family protein (.1.2) Lus10039731 [exp] 81 / 3e-18 AT1G11300 1112 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10018405 [exp] 76 / 1e-16 AT4G21380 952 / 0.0 receptor kinase 3 (.1) Lus10039767 [exp] 74 / 5e-16 AT4G27290 588 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10018516 [exp] 74 / 6e-16 AT1G11300 699 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G028701 [exp] 80 / 4e-18 AT1G11340 899 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028600 [exp] 77 / 7e-17 AT1G11340 875 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.013G121000 [exp] 74 / 8e-16 AT2G19130 863 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028466 [exp] 72 / 2e-15 AT1G11340 884 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.013G149500 [exp] 70 / 1e-14 AT2G19130 838 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G119200 [exp] 69 / 3e-14 AT2G19130 874 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G035700 [exp] 69 / 4e-14 AT1G11340 743 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.010G017450 [exp] 67 / 1e-13 AT4G27290 847 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.010G017800 [exp] 66 / 3e-13 AT4G27290 462 / 1e-156 S-locus lectin protein kinase family protein (.1) Potri.010G015800 [exp] 66 / 3e-13 AT4G27290 844 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01453 [flax] [poplar] B_lectin D-mannose binding lectin
Representative CDS sequence Show only first row Show all	>Lus10015424 pacid=23160857 polypeptide=Lus10015424 locus=Lus10015424.g ID=Lus10015424.BGIv1.0 annot-version=v1.0 ATGGATAATCCTTTCATCAAAGTTCTCTGCGTTCATTTCTTCACTCTCCTCCTGTATATGCACTCCCGCCTCTGCCTCGCTGCCGACAGAATCACTCCGG GTCAATCCCTTTTAGGCAATCAAACCCTCGTTTATGCCGGCGGTGTCTTCTCTTCTGTCATCTCCACTAATTCCTATGTAGGAATTTGGTACCACAAAAT TGTTGAGCAGTTTCACCGCGAACCTTCGGTCTGGGTTTTGAACAGAGACCATCCCGTTCACAACTACGTATCTTTAGTGGAGCTGAGCATAGAGAATGGC ACCCTTATTCTTTACAAGGCTGGCCTGGTCGAATTCCAAATCTATGCTACTGTTGTTACTACTGAACCATTGTTGAATCTGGTAGCTGTGCTCCACGACA ACGGAAATTTCGTGATAAGTGATTCTAATTCGAATCATTATGAACAGTGA
AA sequence Show only first row Show all	>Lus10015424 pacid=23160857 polypeptide=Lus10015424 locus=Lus10015424.g ID=Lus10015424.BGIv1.0 annot-version=v1.0 MDNPFIKVLCVHFFTLLLYMHSRLCLAADRITPGQSLLGNQTLVYAGGVFSSVISTNSYVGIWYHKIVEQFHREPSVWVLNRDHPVHNYVSLVELSIENG TLILYKAGLVEFQIYATVVTTEPLLNLVAVLHDNGNFVISDSNSNHYEQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11340			S-locus lectin protein kinase ...		Lus10015424 [exp]	0	1
AT4G00960			Protein kinase superfamily pro...		Lus10015423 [exp]	1.4	0.8820
AT5G02930			F-box/RNI-like superfamily pro...		Lus10024702 [exp]	2.0	0.8777
AT5G52110		CCB2, HCF208	HIGH CHLOROPHYLL FLUORESCENCE ...		Lus10005770 [exp]	5.2	0.8049
AT2G31290			Ubiquitin carboxyl-terminal hy...		Lus10003062 [exp]	7.0	0.8375
AT4G32850		PAP(IV), PAP(IV...	poly\(A\) polymerase IV, poly\...		Lus10006029 [exp]	8.5	0.8563
AT5G45790			Ubiquitin carboxyl-terminal hy...		Lus10014590 [exp]	10.0	0.7573
AT3G45630			RNA binding (RRM/RBD/RNP motif...		Lus10018126 [exp]	15.8	0.8403
AT5G65380			MATE efflux family protein (.1...		Lus10015905 [exp]	17.2	0.7041
AT4G32700		TEB	TEBICHI, helicases;ATP-depende...		Lus10007673 [exp]	17.9	0.8192
AT5G19280	FHA	RAG1, KAPP	ROOT ATTENUATED GROWTH 1, kina...		Lus10021929 [exp]	19.3	0.7481

Compare expression of checked genes

Lus10015424 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.