Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28250 116 / 3e-35 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014006 [exp] 162 / 2e-53 AT1G28250 133 / 7e-42 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G045400 [exp] 111 / 3e-33 AT1G28250 112 / 9e-34 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015429 pacid=23160905 polypeptide=Lus10015429 locus=Lus10015429.g ID=Lus10015429.BGIv1.0 annot-version=v1.0 ATGGAGAGCAAGAAATCTACCGTATCGCCAGCTGAGGCAGTCTTACTGGGCGCGCTTGCTCCAGGAGTCAACGCTCCTACATGGAACACTCTGAAATCGG CCTTCTTCTTGCTGGCTGCGTCTCTAGCAATAATGCTCGGATTAGCTTTCGCTTCAAGCGACTCTTCCTTGGTGATTCACGTTGGGTTCCTCGTTCTCAT CACTGCTACCCTCTTCTTCCTTCTTAGTTGGTTCCTTTCACAGACTGGTCTGGTTTCAATCGAACAGCAAATGCAGGATCTTGATTTAGCTCCAAAGGAT CGTAACGAGTGA
AA sequence Show only first row Show all	>Lus10015429 pacid=23160905 polypeptide=Lus10015429 locus=Lus10015429.g ID=Lus10015429.BGIv1.0 annot-version=v1.0 MESKKSTVSPAEAVLLGALAPGVNAPTWNTLKSAFFLLAASLAIMLGLAFASSDSSLVIHVGFLVLITATLFFLLSWFLSQTGLVSIEQQMQDLDLAPKD RNE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G28250			unknown protein		Lus10015429 [exp]	0	1
AT1G28250			unknown protein		Lus10014006 [exp]	3.3	0.8167
					Lus10042417 [exp]	4.0	0.8025
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10014077 [exp]	5.1	0.8160
AT5G54590		CRLK1	calcium/calmodulin-regulated r...		Lus10043083 [exp]	6.7	0.8031
AT1G12390			Cornichon family protein (.1)		Lus10004320 [exp]	12.6	0.8021
AT5G25360			unknown protein		Lus10002164 [exp]	14.1	0.7464
AT1G47710			Serine protease inhibitor (SER...		Lus10034364 [exp]	14.2	0.7895
AT1G11070			unknown protein		Lus10038307 [exp]	16.2	0.7900
AT3G07100		AtSEC24A, SEC24...	ENDOPLASMIC RETICULUM MORPHOLO...		Lus10013100 [exp]	16.4	0.7316
					Lus10038131 [exp]	17.2	0.7453

Compare expression of checked genes

Lus10015429 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.