Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28270 76 / 6e-19 RALFL4 ralf-like 4 (.1) AT2G33775 75 / 1e-18 RALFL19 ralf-like 19 (.1) AT4G15800 61 / 4e-13 RALFL33 ralf-like 33 (.1) AT3G16570 60 / 1e-12 ATRALF23, RALFL23 ARABIDOPSIS RAPID ALKALINIZATION FACTOR 23, rapid alkalinization factor 23 (.1) AT3G05490 59 / 3e-12 RALFL22 ralf-like 22 (.1) AT1G02900 56 / 6e-11 RALF1, RALFL1, ATRALF1 RALF-LIKE 1, rapid alkalinization factor 1 (.1) AT4G13950 46 / 2e-07 RALFL31 ralf-like 31 (.1) AT3G23805 46 / 3e-07 RALFL24 ralf-like 24 (.1) AT5G67070 44 / 2e-06 RALFL34 ralf-like 34 (.1) AT2G33130 40 / 4e-05 RALF18, RALFL18 ralf-like 18 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015316 [exp] 106 / 7e-31 AT1G28270 100 / 7e-29 ralf-like 4 (.1) Lus10025444 [exp] 106 / 9e-31 AT1G28270 100 / 2e-28 ralf-like 4 (.1) Lus10005541 [exp] 86 / 5e-23 AT1G28270 69 / 3e-16 ralf-like 4 (.1) Lus10015172 [exp] 64 / 4e-14 AT4G15800 107 / 2e-31 ralf-like 33 (.1) Lus10029893 [exp] 61 / 5e-13 AT4G15800 116 / 8e-35 ralf-like 33 (.1) Lus10020647 [exp] 61 / 1e-12 AT4G15800 119 / 5e-36 ralf-like 33 (.1) Lus10037512 [exp] 59 / 5e-12 AT4G15800 131 / 9e-41 ralf-like 33 (.1) Lus10000502 [exp] 59 / 5e-12 AT4G15800 134 / 1e-41 ralf-like 33 (.1) Lus10016646 [exp] 52 / 2e-09 AT4G13950 100 / 1e-28 ralf-like 31 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G044900 [exp] 76 / 4e-19 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.004G045000 [exp] 76 / 5e-19 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.013G017400 [exp] 61 / 6e-13 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.014G131800 [exp] 61 / 7e-13 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.005G025800 [exp] 59 / 4e-12 AT4G15800 138 / 1e-43 ralf-like 33 (.1) Potri.008G208200 [exp] 56 / 6e-11 AT4G15800 132 / 2e-41 ralf-like 33 (.1) Potri.001G320700 [exp] 48 / 7e-08 AT3G23805 96 / 1e-26 ralf-like 24 (.1) Potri.017G059500 [exp] 47 / 1e-07 AT4G13950 96 / 2e-26 ralf-like 31 (.1) Potri.007G044700 [exp] 47 / 2e-07 AT5G67070 119 / 1e-35 ralf-like 34 (.1) Potri.014G026900 [exp] 45 / 6e-07 AT5G67070 94 / 6e-26 ralf-like 34 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [flax] [poplar] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Lus10015431 pacid=23160926 polypeptide=Lus10015431 locus=Lus10015431.g ID=Lus10015431.BGIv1.0 annot-version=v1.0 ATGGGTTTCCACCACCACCGGTACCGGCTCGTGATCATTATCCTCGCCTTAGCAACAACCATCTTCGCGGAGTCATCAACAACTACGACGAATGTGGACC CCTGCAACGGCGACCCTTGCGACGTCGGGGTAGCTAGGTGGAGGAGGATTGTTGATCGTGGTTGCTCTCTTCCGGACATCAACAACAACATGTTGGCTCG AGAAAGGGATCGGTACATTAGCTACGCAGCACTCGCGGCCAACAACATCCCGTGTGGGAAGCGCGGTAGGTCGTATTACGATTGTAGCGGTCATAAGCGA ATGAACCCTTATAGACGAGGGTGCACTGCAATCACTGGTTGTTACAGGTGGACCCATTGA
AA sequence Show only first row Show all	>Lus10015431 pacid=23160926 polypeptide=Lus10015431 locus=Lus10015431.g ID=Lus10015431.BGIv1.0 annot-version=v1.0 MGFHHHRYRLVIIILALATTIFAESSTTTTNVDPCNGDPCDVGVARWRRIVDRGCSLPDINNNMLARERDRYISYAALAANNIPCGKRGRSYYDCSGHKR MNPYRRGCTAITGCYRWTH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G28270		RALFL4	ralf-like 4 (.1)		Lus10015431 [exp]	0	1
AT1G08315			ARM repeat superfamily protein...		Lus10006007 [exp]	2.8	0.8231
AT5G01300			PEBP (phosphatidylethanolamine...		Lus10003388 [exp]	4.9	0.7810
AT5G01750			Protein of unknown function (D...		Lus10007360 [exp]	5.0	0.7603
AT1G10385			Vps51/Vps67 family (components...		Lus10033648 [exp]	6.9	0.7802
					Lus10019456 [exp]	9.2	0.7739
AT5G61890	AP2_ERF		Integrase-type DNA-binding sup...		Lus10022426 [exp]	12.7	0.7516
AT5G14870		ATCNGC18	cyclic nucleotide-gated channe...		Lus10039415 [exp]	13.7	0.6988
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10024728 [exp]	15.5	0.6991
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10014586 [exp]	25.4	0.6595
AT1G10385			Vps51/Vps67 family (components...		Lus10017692 [exp]	26.8	0.6523

Compare expression of checked genes

Lus10015431 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.