Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G26800 122 / 1e-37 unknown protein AT3G05810 118 / 6e-36 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011180 [exp] 165 / 2e-54 AT5G26800 143 / 1e-45 unknown protein Lus10031426 [exp] 150 / 1e-48 AT5G26800 143 / 8e-46 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G011800 [exp] 128 / 1e-39 AT5G26800 125 / 2e-38 unknown protein Potri.013G007600 [exp] 119 / 3e-36 AT3G05810 116 / 5e-35 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0003 [flax] [poplar] SAM PF09597 [flax] [poplar] IGR IGR protein motif
Representative CDS sequence Show only first row Show all	>Lus10015444 pacid=23160941 polypeptide=Lus10015444 locus=Lus10015444.g ID=Lus10015444.BGIv1.0 annot-version=v1.0 ATGGCGCTTCTGCGGCTGCTATCATCATCGGAGGCGAAGCTTCCGGCAGCTACTGGATTTTCCAGATTCTACTCTCAGTCATCGCCTTATCTTGTGAAAG TTGGGATCCCGGAGTTCCTGAATGGGATAGGGAAAGGTGTTGAAACCCATGTGGCCAAGCTCGAAACTGAGATCGGAGACTTCCAAAAGCTTCTAGTTAC CAGGACTTTGAAGCTCAAGAAACTAGGAATCCCTTGCCAACATAGGAAGCTGATATTGAACTATGCACAGAAGTATAGGCTAGGACTGTGGCGGCCGAGA GCAGAACCTCTTAAAGTCAAGTGA
AA sequence Show only first row Show all	>Lus10015444 pacid=23160941 polypeptide=Lus10015444 locus=Lus10015444.g ID=Lus10015444.BGIv1.0 annot-version=v1.0 MALLRLLSSSEAKLPAATGFSRFYSQSSPYLVKVGIPEFLNGIGKGVETHVAKLETEIGDFQKLLVTRTLKLKKLGIPCQHRKLILNYAQKYRLGLWRPR AEPLKVK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G26800			unknown protein		Lus10015444 [exp]	0	1
AT1G80750			Ribosomal protein L30/L7 famil...		Lus10040040 [exp]	5.7	0.9171
AT3G02080			Ribosomal protein S19e family ...		Lus10033532 [exp]	5.7	0.9040
AT5G02610			Ribosomal L29 family protein ...		Lus10019179 [exp]	6.4	0.9191
AT3G46560		TIM9, EMB2474	embryo defective 2474, Tim10/D...		Lus10038695 [exp]	6.9	0.9164
AT4G14320			Zinc-binding ribosomal protein...		Lus10010195 [exp]	7.9	0.9173
AT5G53900			Serine/threonine-protein kinas...		Lus10005549 [exp]	8.5	0.8657
AT2G46230			PIN domain-like family protein...		Lus10010134 [exp]	11.0	0.9151
AT5G26800			unknown protein		Lus10011180 [exp]	11.6	0.9044
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10014676 [exp]	16.0	0.9155
AT2G40660			Nucleic acid-binding, OB-fold-...		Lus10029026 [exp]	16.2	0.9103

Compare expression of checked genes

Lus10015444 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.