Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011181 [exp] 86 / 8e-24 AT5G49525 50 / 5e-10 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015445 pacid=23160930 polypeptide=Lus10015445 locus=Lus10015445.g ID=Lus10015445.BGIv1.0 annot-version=v1.0 ATGGCGGGAGCGTGGCCGACAGTTGCGTTAAGGTGCCTGAGCTTCGGATTCACCTACTCCTCCCTCCAGCAGGGAGTCCGGAACTGGGGGCAGCAGCGGT GGCCGGAGCTGGGGTTCTCGATCGTCGACGACGTCGTCTGGAGCTTGGTCTCAGCGGTGGAGTCCGTAGCCCTTGTATTGATGCTCTGCTTCTTCTTCCT CTTCTGCGGATGCACCTTCTGA
AA sequence Show only first row Show all	>Lus10015445 pacid=23160930 polypeptide=Lus10015445 locus=Lus10015445.g ID=Lus10015445.BGIv1.0 annot-version=v1.0 MAGAWPTVALRCLSFGFTYSSLQQGVRNWGQQRWPELGFSIVDDVVWSLVSAVESVALVLMLCFFFLFCGCTF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10015445 [exp]	0	1
AT4G38220		AQI	aquaporin interactor, Peptidas...		Lus10013848 [exp]	7.7	0.8149
AT3G18840			Tetratricopeptide repeat (TPR)...		Lus10001445 [exp]	13.0	0.7000
AT2G38130		ATMAK3	Acyl-CoA N-acyltransferases (N...		Lus10012579 [exp]	14.0	0.7326
AT3G52155			Phosphoglycerate mutase family...		Lus10040405 [exp]	19.4	0.7339
AT3G18490			Eukaryotic aspartyl protease f...		Lus10032481 [exp]	20.7	0.7966
AT4G16490			ARM repeat superfamily protein...		Lus10017563 [exp]	21.8	0.7941
AT4G16490			ARM repeat superfamily protein...		Lus10017562 [exp]	24.3	0.7847
AT3G58840		PMD1	peroxisomal and mitochondrial ...		Lus10007347 [exp]	27.8	0.7806
AT1G02370			Tetratricopeptide repeat (TPR)...		Lus10021053 [exp]	33.6	0.7563
AT4G17600		LIL3:1	Chlorophyll A-B binding family...		Lus10011016 [exp]	37.6	0.7694

Compare expression of checked genes

Lus10015445 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.