Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015452 pacid=23173599 polypeptide=Lus10015452 locus=Lus10015452.g ID=Lus10015452.BGIv1.0 annot-version=v1.0 ATGAAGGTAGTCGCTGATGAGTTGAAGTTTACGCACTGGCTCATGACAGCAGGAAATGTACCACATTTAGGATGCACAATCAGCTTGGTAGCGTTATTGG AGAAGCGTATTGAACGGCCATGGAACTTCAGTTGTGCAGAGGCAGCAGAACCTGGAACCCTTGCTACAATGGAGACAAAACCATACCTACAACATGCATA G
AA sequence Show only first row Show all	>Lus10015452 pacid=23173599 polypeptide=Lus10015452 locus=Lus10015452.g ID=Lus10015452.BGIv1.0 annot-version=v1.0 MKVVADELKFTHWLMTAGNVPHLGCTISLVALLEKRIERPWNFSCAEAAEPGTLATMETKPYLQHA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10015452 [exp]	0	1
AT5G10990			SAUR-like auxin-responsive pro...		Lus10026297 [exp]	53.1	0.5675
AT5G20900	ZIM	TIFY3B, JAZ12	jasmonate-zim-domain protein 1...		Lus10011929 [exp]	54.3	0.6060
AT3G24730			mRNA splicing factor, thioredo...		Lus10022811 [exp]	62.0	0.6212
AT5G40570			Surfeit locus protein 2 (SURF2...		Lus10003658 [exp]	94.0	0.5897
AT4G40042			Microsomal signal peptidase 12...		Lus10037011 [exp]	100.4	0.5836
AT5G16780		MDF, DOT2	MERISTEM-DEFECTIVE, DEFECTIVEL...		Lus10023155 [exp]	130.3	0.5733
AT5G48385			FRIGIDA-like protein (.1)		Lus10001723 [exp]	181.0	0.5452
AT2G29410		ATMTPB1, MTPB1	metal tolerance protein B1 (.1...		Lus10040744 [exp]	198.5	0.5386
AT3G47940			DNAJ heat shock family protein...		Lus10036668 [exp]	214.4	0.5461

Compare expression of checked genes

Lus10015452 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.