Lus10015462 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G60950 105 / 1e-29 FED A, ATFD2, FEDA FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
AT1G10960 85 / 2e-21 ATFD1 ferredoxin 1 (.1)
AT2G27510 78 / 8e-19 ATFD3 ferredoxin 3 (.1)
AT1G32550 57 / 8e-11 FdC1 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
AT5G10000 53 / 2e-09 ATFD4 ferredoxin 4 (.1)
AT4G14890 39 / 0.0004 FdC2 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001369 169 / 1e-54 AT1G60950 186 / 1e-61 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10020616 84 / 4e-21 AT2G27510 172 / 9e-56 ferredoxin 3 (.1)
Lus10004870 81 / 7e-20 AT2G27510 165 / 5e-53 ferredoxin 3 (.1)
Lus10043430 77 / 2e-18 AT2G27510 179 / 3e-58 ferredoxin 3 (.1)
Lus10034144 76 / 8e-18 AT2G27510 179 / 1e-58 ferredoxin 3 (.1)
Lus10000483 49 / 1e-07 AT1G32550 245 / 7e-84 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Lus10004576 49 / 2e-07 AT1G32550 248 / 6e-85 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Lus10006116 45 / 4e-06 AT4G14890 186 / 1e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10010557 44 / 9e-06 AT4G14890 188 / 5e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G218400 104 / 2e-29 AT1G60950 194 / 9e-65 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.003G015200 100 / 9e-28 AT1G60950 176 / 2e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.001G470700 94 / 4e-25 AT1G60950 174 / 7e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.009G163800 84 / 2e-21 AT2G27510 167 / 7e-54 ferredoxin 3 (.1)
Potri.010G239100 79 / 4e-19 AT2G27510 175 / 7e-57 ferredoxin 3 (.1)
Potri.004G202500 78 / 2e-18 AT2G27510 164 / 3e-52 ferredoxin 3 (.1)
Potri.008G020100 77 / 2e-18 AT2G27510 180 / 5e-59 ferredoxin 3 (.1)
Potri.003G090400 53 / 3e-09 AT1G32550 257 / 3e-88 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Potri.010G087300 39 / 0.0003 AT4G14890 189 / 7e-63 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.008G153200 39 / 0.0003 AT4G14890 193 / 2e-64 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0486 Fer2 PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Representative CDS sequence
>Lus10015462 pacid=23173623 polypeptide=Lus10015462 locus=Lus10015462.g ID=Lus10015462.BGIv1.0 annot-version=v1.0
ATGGCGGCAACAGCAGCAGTAAGCAGCAGCCCGATGGTGAGCGCCAAGTTCACAAGGCCTAACCCATCATCATCATCATCGTCCTTAAAGGCACTCATCC
CTACTACCAACTTCAGCTTCGGCGGCCTCAAATCATCATCATCCTTCGGAGGGCGCGGACTAAGCGTGGTGGCGAATTACAAGGTTACACTCAAGACCCC
TGAAGGAGAAGTGAGCTTCGACTGCCCAGACGACGTCTACATTCTTGACCAAGCCGAGGAGGAAGGCATTGACTTGCCTTACTCTTGCAGGGCTGGCTCC
TGCTCCTCCTGCGCCGGCAAAGTCGTCGCCGGTTCACTTGACCAGTCTGACCAGAGCTTCCTCGACGACGAACAGCTCGCTGAAGGTTGGGCCTTGACCT
GCGTCGCCTACCCTTCTTCCGATGTCACCATTGAGACCCACAAGGAGGAAGAGCTCACCGCCTAA
AA sequence
>Lus10015462 pacid=23173623 polypeptide=Lus10015462 locus=Lus10015462.g ID=Lus10015462.BGIv1.0 annot-version=v1.0
MAATAAVSSSPMVSAKFTRPNPSSSSSSLKALIPTTNFSFGGLKSSSSFGGRGLSVVANYKVTLKTPEGEVSFDCPDDVYILDQAEEEGIDLPYSCRAGS
CSSCAGKVVAGSLDQSDQSFLDDEQLAEGWALTCVAYPSSDVTIETHKEEELTA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G60950 FED A, ATFD2, F... FERREDOXIN 2, 2Fe-2S ferredoxi... Lus10015462 0 1
AT1G60950 FED A, ATFD2, F... FERREDOXIN 2, 2Fe-2S ferredoxi... Lus10001369 1.0 0.9822
AT5G18660 PCB2, DVR PALE-GREEN AND CHLOROPHYLL B R... Lus10037912 2.0 0.9574
AT3G61870 unknown protein Lus10012617 2.4 0.9565
AT4G25910 ATCNFU3, NFU3 NFU domain protein 3 (.1) Lus10001634 2.8 0.9491
AT5G18660 PCB2, DVR PALE-GREEN AND CHLOROPHYLL B R... Lus10038638 5.5 0.9379
AT2G40490 HEME2 Uroporphyrinogen decarboxylase... Lus10012892 6.0 0.9306
AT2G06520 PSBX photosystem II subunit X (.1) Lus10025007 7.5 0.9439
AT1G54500 Rubredoxin-like superfamily pr... Lus10019005 7.7 0.9440
AT1G55670 PSAG photosystem I subunit G (.1) Lus10028806 8.1 0.9454
AT1G61520 LHCA3*1, LHCA3*... photosystem I light harvesting... Lus10016074 8.4 0.9439

Lus10015462 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.