Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44670 63 / 5e-12 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT3G44400 61 / 3e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT3G25510 61 / 3e-11 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT4G16960 60 / 7e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G16940 57 / 7e-10 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT2G17060 56 / 1e-09 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G69550 56 / 1e-09 disease resistance protein (TIR-NBS-LRR class) (.1) AT3G44630 56 / 2e-09 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT5G17680 56 / 2e-09 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G46490 55 / 4e-09 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001366 [exp] 262 / 1e-81 AT5G36930 424 / 1e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10004257 [exp] 122 / 2e-32 AT5G36930 446 / 7e-136 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10042165 [exp] 110 / 1e-28 AT5G36930 326 / 9e-94 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10001038 [exp] 107 / 1e-28 AT1G69550 112 / 2e-27 disease resistance protein (TIR-NBS-LRR class) (.1) Lus10029628 [exp] 108 / 9e-28 AT1G27180 462 / 1e-138 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10001375 [exp] 106 / 4e-27 AT5G36930 464 / 3e-141 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10037406 [exp] 102 / 2e-25 AT5G36930 395 / 5e-116 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10023272 [exp] 101 / 3e-25 AT5G36930 423 / 4e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10041559 [exp] 96 / 6e-25 AT1G69550 88 / 9e-20 disease resistance protein (TIR-NBS-LRR class) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G030318 [exp] 69 / 6e-14 AT1G69550 673 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1) Potri.005G031101 [exp] 64 / 2e-12 AT5G17680 557 / 8e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.015G043600 [exp] 57 / 9e-10 AT1G27170 1195 / 0.0 transmembrane receptors;ATP binding (.1.2) Potri.019G068300 [exp] 56 / 2e-09 AT5G17680 580 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G037599 [exp] 55 / 4e-09 AT5G36930 627 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G070001 [exp] 54 / 6e-09 AT5G17680 481 / 5e-148 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070565 [exp] 54 / 6e-09 AT5G17680 482 / 3e-148 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.012G135700 [exp] 54 / 1e-08 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G001600 [exp] 53 / 2e-08 AT5G36930 721 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G069600 [exp] 53 / 2e-08 AT5G17680 647 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Lus10015465 pacid=23173625 polypeptide=Lus10015465 locus=Lus10015465.g ID=Lus10015465.BGIv1.0 annot-version=v1.0 ATGAGTGGTTGCAAGTCAATTGAGAAATTGCCAAATGTTTCGAATCTTGGATCATGTCTAAAGACCCTGTCATTAAGCAACTGCGAGAGGTTGGTTGAGG TGTCTGGAATCGAGGAGTTGAGGTCCTTGATAGTGCTGGACATGAGTGGCTGCAAGTCAATTGAGAAATTGCCAAATCTTTCAAATCTGGGATCATGCCT AGAGACCCTGTCATTAAGCAACTGCGACAAGTTGATTGATGTTGCAGGAATTGAGGAGCTGAGTTCCTTGGATGTGCTAGACATGAAAGGCTGCAAGTCA ATTCAGAAGTTGCCAAATCTTTCGAATCTCAGACTAGAAACCCTGTCTCTAAGCAGCTGCGAGAAGTTGGTTGAGGTGTCTGGAACTGAGGAACAGAAGT GCTTGAAAGTGCTGGAGATGAATGGCTGCAAGTCGATCGAGATGCTGCAGCTCTCTAAAAGCTGTTATTTGGAGACTCTTTTCTCTGAGTGGTTGTGA
AA sequence Show only first row Show all	>Lus10015465 pacid=23173625 polypeptide=Lus10015465 locus=Lus10015465.g ID=Lus10015465.BGIv1.0 annot-version=v1.0 MSGCKSIEKLPNVSNLGSCLKTLSLSNCERLVEVSGIEELRSLIVLDMSGCKSIEKLPNLSNLGSCLETLSLSNCDKLIDVAGIEELSSLDVLDMKGCKS IQKLPNLSNLRLETLSLSSCEKLVEVSGTEEQKCLKVLEMNGCKSIEMLQLSKSCYLETLFSEWL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G44670			Disease resistance protein (TI...		Lus10015465 [exp]	0	1
AT5G47810		PFK2	phosphofructokinase 2 (.1)		Lus10039993 [exp]	3.2	0.8281
AT5G61280			Remorin family protein (.1)		Lus10034714 [exp]	3.6	0.8345
AT5G28910			unknown protein		Lus10027959 [exp]	5.1	0.7639
AT1G04480			Ribosomal protein L14p/L23e fa...		Lus10008065 [exp]	7.2	0.8177
AT1G77460			Armadillo/beta-catenin-like re...		Lus10029691 [exp]	7.2	0.7345
AT2G45910			U-box domain-containing protei...		Lus10014771 [exp]	8.5	0.8185
AT3G20530			Protein kinase superfamily pro...		Lus10019621 [exp]	8.5	0.7997
AT5G39710		EMB2745	EMBRYO DEFECTIVE 2745, Tetratr...		Lus10022739 [exp]	8.9	0.8121
AT1G05170			Galactosyltransferase family p...		Lus10001148 [exp]	10.1	0.8106
AT5G06600		AtUBP12, UBP12	ubiquitin-specific protease 12...		Lus10027030 [exp]	11.5	0.8030

Compare expression of checked genes

Lus10015465 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.