Lus10015472 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48540 41 / 6e-05 receptor-like protein kinase-related family protein (.1)
AT4G05200 41 / 0.0001 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
AT3G22030 39 / 0.0004 Receptor protein kinase-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028019 140 / 8e-44 AT1G70530 44 / 8e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1)
Lus10012369 133 / 5e-41 AT4G11470 42 / 6e-05 cysteine-rich RLK (RECEPTOR-like protein kinase) 31 (.1)
Lus10028018 107 / 1e-30 ND 39 / 5e-04
Lus10003724 94 / 4e-25 AT1G70530 45 / 7e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1)
Lus10028017 75 / 2e-16 AT1G03250 316 / 1e-106 unknown protein
Lus10033450 67 / 5e-15 AT1G19090 45 / 7e-06 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)
Lus10020927 63 / 3e-13 AT1G19090 45 / 7e-06 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)
Lus10033389 60 / 4e-12 AT1G19090 44 / 2e-05 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)
Lus10011894 57 / 5e-11 AT3G60720 38 / 9e-04 plasmodesmata-located protein 8 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G025900 47 / 7e-07 AT4G23130 573 / 0.0 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2)
Potri.004G024900 47 / 7e-07 AT4G23180 506 / 1e-171 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.005G208400 45 / 1e-06 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
Potri.004G024404 46 / 2e-06 AT4G23180 671 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.011G028100 44 / 1e-05 AT4G05200 519 / 8e-177 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.002G249600 43 / 1e-05 AT5G48540 256 / 7e-86 receptor-like protein kinase-related family protein (.1)
Potri.004G024500 43 / 2e-05 AT4G23180 675 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G025001 43 / 2e-05 AT4G05200 465 / 4e-158 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.011G027900 43 / 2e-05 AT4G23180 542 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.011G027800 43 / 2e-05 AT4G23180 516 / 9e-176 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10015472 pacid=23173670 polypeptide=Lus10015472 locus=Lus10015472.g ID=Lus10015472.BGIv1.0 annot-version=v1.0
ATGGCGTCCACAGTTCTAGTACTGCTAGCGATCTCCGGAGTCGTCGTTCTAATAATCGGATCGGTCGAGCATGTAAGGAGCATGGAAGTGAACACCTGTG
TATGCAGCACCTTCAAGTATCCAGCGCACGATGTGAAGAGATTCCTCGTCGAAGACCTTCTAGAAGACCTGGCGAAAAGTCCGATATCTCACTGGAGGGA
TCGCGCCCTGGCGTTATCGATTCCCAGGAAGCACCCTTTGATTTACGCCTACGCCAACTGCACTGCTCCTGCTTATCGTGAGTCCGATGTCCATGACTGT
AACCAATGTCTGAGGCTGGCCAAACGGAACTTACTCCGTAACTGTCCCCATCGGGTTGGGGCACAAGTGTATTTTGACCTTTGTTATATGAGGTACGAAG
CTTACCCTTTTTGA
AA sequence
>Lus10015472 pacid=23173670 polypeptide=Lus10015472 locus=Lus10015472.g ID=Lus10015472.BGIv1.0 annot-version=v1.0
MASTVLVLLAISGVVVLIIGSVEHVRSMEVNTCVCSTFKYPAHDVKRFLVEDLLEDLAKSPISHWRDRALALSIPRKHPLIYAYANCTAPAYRESDVHDC
NQCLRLAKRNLLRNCPHRVGAQVYFDLCYMRYEAYPF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G48540 receptor-like protein kinase-r... Lus10015472 0 1
AT2G18370 Bifunctional inhibitor/lipid-t... Lus10001431 3.0 1.0000
AT5G14400 CYP724A1 "cytochrome P450, family 724, ... Lus10003650 3.2 1.0000
Lus10003840 5.2 1.0000
Lus10012429 5.5 1.0000
Lus10005396 6.0 1.0000
AT3G05950 RmlC-like cupins superfamily p... Lus10029010 7.0 1.0000
Lus10022573 7.3 1.0000
Lus10007179 7.9 1.0000
Lus10006661 8.5 1.0000
Lus10021548 9.2 1.0000

Lus10015472 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.