Lus10015493 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30550 96 / 6e-25 GGP3 gamma-glutamyl peptidase 3, Class I glutamine amidotransferase-like superfamily protein (.1)
AT2G23970 92 / 1e-23 Class I glutamine amidotransferase-like superfamily protein (.1)
AT4G30540 84 / 2e-20 Class I glutamine amidotransferase-like superfamily protein (.1)
AT2G23960 77 / 6e-18 Class I glutamine amidotransferase-like superfamily protein (.1)
AT4G30530 77 / 1e-17 GGP1 gamma-glutamyl peptidase 1, Class I glutamine amidotransferase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019964 192 / 2e-62 AT2G23970 279 / 6e-95 Class I glutamine amidotransferase-like superfamily protein (.1)
Lus10014635 94 / 3e-24 AT2G23970 233 / 8e-77 Class I glutamine amidotransferase-like superfamily protein (.1)
Lus10033793 94 / 4e-24 AT2G23970 239 / 4e-79 Class I glutamine amidotransferase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G102000 159 / 7e-50 AT2G23970 308 / 1e-106 Class I glutamine amidotransferase-like superfamily protein (.1)
Potri.009G078200 104 / 2e-28 AT2G23970 211 / 1e-68 Class I glutamine amidotransferase-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10015493 pacid=23173638 polypeptide=Lus10015493 locus=Lus10015493.g ID=Lus10015493.BGIv1.0 annot-version=v1.0
ATGGAGGATACTTCAATGTGTTCGTTGCTGCGTTTGGTGAAGGAGGAGGAGGAGGAGGAGAGAGATGGGATTTGTTCAGAGTTGTGGATGGTGAGTTCCC
TCACATGGAAGATCTTCACAAGGAAAGCAATGAGAGGATGGGATATTGGGTTAAGAAGGGTGAGGATTGTGAAGGATTTGAGACTATGGAGTTTCTTAGA
AGATGTGAAGCAAATGCCACCATCTCTATCAATCATTGAGGGCCACCAAGATCAAGTGTGGGAGGTTCCATCTGGAGCAGAGGTGATTGCATTCTCAGAC
ACAACTGGTGTGGAGATGTTCACCATTGGAGATCACATCCTGGGGATTCAAGGCCATCCTGAATACACTAACGACATTCTTTGTAGCCTCATTGACCGCC
TTTTTCAAGCCAACTGCATCGAGGTACCTTAA
AA sequence
>Lus10015493 pacid=23173638 polypeptide=Lus10015493 locus=Lus10015493.g ID=Lus10015493.BGIv1.0 annot-version=v1.0
MEDTSMCSLLRLVKEEEEEERDGICSELWMVSSLTWKIFTRKAMRGWDIGLRRVRIVKDLRLWSFLEDVKQMPPSLSIIEGHQDQVWEVPSGAEVIAFSD
TTGVEMFTIGDHILGIQGHPEYTNDILCSLIDRLFQANCIEVP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G30550 GGP3 gamma-glutamyl peptidase 3, Cl... Lus10015493 0 1
Lus10017955 1.0 0.9939
AT2G24960 unknown protein Lus10042421 1.4 0.9913
Lus10039496 2.4 0.9894
Lus10009927 2.8 0.9846
AT5G19440 NAD(P)-binding Rossmann-fold s... Lus10008669 3.0 0.9724
AT5G05340 Peroxidase superfamily protein... Lus10030149 3.5 0.9764
Lus10018837 4.5 0.9800
AT1G33400 TPR9 tetratricopeptide repeat 9, Te... Lus10042464 4.5 0.9680
AT1G62960 ACS10 ACC synthase 10 (.1) Lus10011796 6.0 0.9354
AT3G28540 P-loop containing nucleoside t... Lus10007270 6.3 0.9726

Lus10015493 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.