Lus10015504 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28030 134 / 1e-39 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
AT2G06025 43 / 2e-05 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019975 265 / 9e-91 AT4G28030 322 / 3e-111 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G176500 113 / 2e-31 AT4G28030 284 / 2e-96 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
PFAM info
Representative CDS sequence
>Lus10015504 pacid=23173671 polypeptide=Lus10015504 locus=Lus10015504.g ID=Lus10015504.BGIv1.0 annot-version=v1.0
ATGGCGCTCGTTTCATCTTCACCTCCGATCCCTCCATTCTCTTGCCGTATCTCTTCACAGCCGCCGACGGCTCACAACCGTCATTCTCACATACTGTTCT
CCTCTCCCGCTCGCTCCTTTCGCCTCCAATCGATCGCACCTCCATCGGAAGTGTGCTCACCCTACGAGCTCGACAAATCGACCGTCTCAATCTCTGTCGC
TGACTCCGACGACGAGCTCTGGGCCGCCGCCCGCCTCCGCACTCGGTCGTTCCACGAGTTTAACTCGTCATCATACGGCATCCAGGAGCACAGGAAATAC
TTAGCTGAGAAAGAGTTTGAAGCAATGAAGGAACGGATTGATGGGATGAGGCCGATGTTTAAGAAGGTTTCTTGCATTAATGCCACTCTTCCGCTATCTC
AATTTAGCGAAGTTTGCGAAGATCTGTGCTCCGAATGTAAGGTTTGA
AA sequence
>Lus10015504 pacid=23173671 polypeptide=Lus10015504 locus=Lus10015504.g ID=Lus10015504.BGIv1.0 annot-version=v1.0
MALVSSSPPIPPFSCRISSQPPTAHNRHSHILFSSPARSFRLQSIAPPSEVCSPYELDKSTVSISVADSDDELWAAARLRTRSFHEFNSSSYGIQEHRKY
LAEKEFEAMKERIDGMRPMFKKVSCINATLPLSQFSEVCEDLCSECKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G28030 Acyl-CoA N-acyltransferases (N... Lus10015504 0 1
AT1G04780 Ankyrin repeat family protein ... Lus10011743 1.4 0.9035
AT5G19540 unknown protein Lus10034912 1.4 0.9091
AT5G59250 Major facilitator superfamily ... Lus10016505 2.4 0.9030
AT5G27270 EMB976 EMBRYO DEFECTIVE 976, Tetratri... Lus10015739 4.2 0.8858
AT1G32060 PRK phosphoribulokinase (.1) Lus10030949 4.9 0.8978
AT2G43560 FKBP-like peptidyl-prolyl cis-... Lus10008359 5.3 0.8736
AT1G58170 Disease resistance-responsive ... Lus10042488 6.2 0.8460
AT2G23820 Metal-dependent phosphohydrola... Lus10015497 7.7 0.8733
AT2G31040 ATP synthase protein I -relate... Lus10020702 8.1 0.8803
AT5G14370 CCT motif family protein (.1) Lus10022311 9.6 0.8533

Lus10015504 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.