Lus10015506 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18670 102 / 3e-28 RING/U-box superfamily protein (.1)
AT4G30370 88 / 9e-23 RING/U-box superfamily protein (.1)
AT4G09100 66 / 2e-14 RING/U-box superfamily protein (.1)
AT5G42200 63 / 4e-13 RING/U-box superfamily protein (.1)
AT2G27940 63 / 8e-13 RING/U-box superfamily protein (.1)
AT3G16720 62 / 3e-12 ATL2 TOXICOS EN LEVADURA 2 (.1)
AT3G48030 62 / 3e-12 hypoxia-responsive family protein / zinc finger (C3HC4-type RING finger) family protein (.1)
AT3G62690 61 / 4e-12 ATL5 AtL5 (.1)
AT4G28890 60 / 2e-11 RING/U-box superfamily protein (.1)
AT2G42360 59 / 4e-11 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019979 218 / 3e-74 AT2G18670 113 / 5e-32 RING/U-box superfamily protein (.1)
Lus10008797 70 / 4e-15 AT5G40250 77 / 2e-16 RING/U-box superfamily protein (.1)
Lus10022223 68 / 1e-14 AT1G23980 81 / 2e-17 RING/U-box superfamily protein (.1)
Lus10012975 66 / 3e-13 AT2G20030 291 / 2e-95 RING/U-box superfamily protein (.1)
Lus10034953 63 / 3e-12 AT2G20030 278 / 2e-90 RING/U-box superfamily protein (.1)
Lus10016163 61 / 4e-12 AT2G27940 133 / 1e-38 RING/U-box superfamily protein (.1)
Lus10042277 61 / 1e-11 AT3G16720 104 / 2e-26 TOXICOS EN LEVADURA 2 (.1)
Lus10034551 58 / 1e-11 AT5G42200 112 / 2e-32 RING/U-box superfamily protein (.1)
Lus10023617 60 / 2e-11 AT5G05810 219 / 1e-68 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G098100 122 / 2e-36 AT2G18670 91 / 2e-23 RING/U-box superfamily protein (.1)
Potri.018G098000 112 / 2e-32 AT2G18670 87 / 6e-22 RING/U-box superfamily protein (.1)
Potri.006G175700 112 / 6e-32 AT2G18670 91 / 1e-22 RING/U-box superfamily protein (.1)
Potri.002G017400 73 / 5e-17 AT5G42200 154 / 2e-48 RING/U-box superfamily protein (.1)
Potri.005G244500 71 / 4e-16 AT5G42200 149 / 3e-46 RING/U-box superfamily protein (.1)
Potri.002G153400 64 / 2e-13 AT2G20030 83 / 8e-19 RING/U-box superfamily protein (.1)
Potri.005G108200 63 / 6e-13 AT4G35840 369 / 7e-131 RING/U-box superfamily protein (.1)
Potri.018G042501 64 / 8e-13 AT2G20030 244 / 2e-77 RING/U-box superfamily protein (.1)
Potri.018G085001 64 / 8e-13 AT4G28890 290 / 2e-94 RING/U-box superfamily protein (.1)
Potri.014G076800 61 / 3e-12 AT4G10150 84 / 1e-19 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10015506 pacid=23173597 polypeptide=Lus10015506 locus=Lus10015506.g ID=Lus10015506.BGIv1.0 annot-version=v1.0
ATGATCCTGAAAGCCCTAATTATGTTCTTCATAACCACTACCTTCTGCTTCTTCCTCGGCGTGGCCGCAATCCTCCTCCTGATCGCAACCTTGGCCTTCC
ACCGCCACACCAAATCCAATCCGTCCGACTACCTGAAGAAACTCCCCGATTTCAGATTCCCGAATAGGACGATATCGGAAGAAGGGGAGGTCGAGTGCGT
TGTTTGCCTCGACGGGATTAAGCAAGGGCAATGGTGCAGGATGCTTTGCGGCTGTGGACACGTATTCCATCGCCGATGCGTGGATACTTGGCTGTCGAAG
GTTCCCTCTTGCCCGATTTGTCGCGCTAGGGTTCAATTAGATTCAGGGAGTTGGGCTCAAGAAAGGAAGCCTTGTCTTGGTTGGATTGGAAGAACAAGTT
GA
AA sequence
>Lus10015506 pacid=23173597 polypeptide=Lus10015506 locus=Lus10015506.g ID=Lus10015506.BGIv1.0 annot-version=v1.0
MILKALIMFFITTTFCFFLGVAAILLLIATLAFHRHTKSNPSDYLKKLPDFRFPNRTISEEGEVECVVCLDGIKQGQWCRMLCGCGHVFHRRCVDTWLSK
VPSCPICRARVQLDSGSWAQERKPCLGWIGRTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18670 RING/U-box superfamily protein... Lus10015506 0 1
AT3G23250 MYB ATMYB15, ATY19 myb domain protein 15 (.1.2) Lus10033889 1.0 0.9878
AT3G14630 CYP72A9 "cytochrome P450, family 72, s... Lus10017775 2.0 0.9811
AT1G66880 Protein kinase superfamily pro... Lus10028494 3.0 0.9795
AT4G31550 WRKY ATWRKY11, WRKY1... WRKY DNA-binding protein 11 (.... Lus10026936 3.3 0.9747
AT4G12080 AT-hook ATAHL1, AHL1 AT-hook motif nuclear-localize... Lus10003371 4.8 0.9683
AT1G47530 MATE efflux family protein (.1... Lus10042344 5.5 0.9782
AT2G27510 ATFD3 ferredoxin 3 (.1) Lus10020616 5.8 0.9706
AT5G19140 AtAILP1, AILP1 Aluminium induced protein with... Lus10034038 5.9 0.9753
AT1G71696 SOL1.4, SOL1.3,... SUPPRESSOR OF LLP1 1, carboxyp... Lus10028694 6.2 0.9698
AT2G19860 ATHXK2 ARABIDOPSIS THALIANA HEXOKINAS... Lus10012946 6.7 0.9748

Lus10015506 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.