Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27550 70 / 1e-16 ATC centroradialis (.1) AT5G03840 60 / 1e-12 TFL-1, TFL1 TERMINAL FLOWER 1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT5G62040 52 / 1e-09 BFT brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT1G65480 44 / 1e-06 FT FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043385 [exp] 108 / 3e-31 AT2G27550 259 / 2e-89 centroradialis (.1) Lus10019518 [exp] 104 / 1e-30 AT2G27550 140 / 2e-43 centroradialis (.1) Lus10019541 [exp] 94 / 8e-26 AT2G27550 188 / 5e-62 centroradialis (.1) Lus10020600 [exp] 77 / 3e-19 AT2G27550 263 / 3e-91 centroradialis (.1) Lus10004886 [exp] 72 / 3e-17 AT2G27550 267 / 2e-92 centroradialis (.1) Lus10004884 [exp] 71 / 8e-17 AT2G27550 218 / 3e-73 centroradialis (.1) Lus10017052 [exp] 59 / 5e-13 AT5G03840 108 / 2e-31 TERMINAL FLOWER 1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10021372 [exp] 61 / 7e-13 AT5G03840 267 / 1e-92 TERMINAL FLOWER 1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10027442 [exp] 55 / 2e-10 AT5G62040 248 / 4e-85 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G203900 [exp] 77 / 5e-19 AT2G27550 286 / 4e-100 centroradialis (.1) Potri.009G165100 [exp] 76 / 1e-18 AT2G27550 293 / 7e-103 centroradialis (.1) Potri.015G141300 [exp] 57 / 9e-12 AT5G62040 217 / 1e-73 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.008G077700 [exp] 46 / 2e-07 AT1G65480 257 / 8e-89 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.010G179801 [exp] 44 / 4e-07 AT1G65480 133 / 3e-41 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.010G179900 [exp] 44 / 5e-07 AT1G65480 132 / 6e-41 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.010G179700 [exp] 43 / 2e-06 AT1G65480 286 / 2e-100 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015520 pacid=23173645 polypeptide=Lus10015520 locus=Lus10015520.g ID=Lus10015520.BGIv1.0 annot-version=v1.0 ATGTCGTCAGATCCTCTAGTGATAGGGAGAGTGATTGGAGACGTTGTTGATGGATTGAATCCAAGTACTGTTAAGATGGCAGTCACTTACAGCTCTGCTA ATAAACAAGTATTTAATGGCCATGAGTTCTTCCCTTCTGCTGTTACTCAGAAGCCTAAGGTTGAAGTTCTTGGCGCTAATCTTAGGTCCTTCTTCACTCT GGTAAAAACCCACATCCAATTTCTGACTTCAAAACCAAGATGTGCCTGGTCCAAGTGA
AA sequence Show only first row Show all	>Lus10015520 pacid=23173645 polypeptide=Lus10015520 locus=Lus10015520.g ID=Lus10015520.BGIv1.0 annot-version=v1.0 MSSDPLVIGRVIGDVVDGLNPSTVKMAVTYSSANKQVFNGHEFFPSAVTQKPKVEVLGANLRSFFTLVKTHIQFLTSKPRCAWSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27550		ATC	centroradialis (.1)		Lus10015520 [exp]	0	1
					Lus10005608 [exp]	3.7	0.8088
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10024728 [exp]	4.0	0.7899
					Lus10039418 [exp]	5.7	0.7610
AT3G48310		CYP71A22	"cytochrome P450, family 71, s...		Lus10027397 [exp]	9.2	0.7160
AT3G25810			Terpenoid cyclases/Protein pre...		Lus10025922 [exp]	10.8	0.7302
AT3G25810			Terpenoid cyclases/Protein pre...		Lus10001110 [exp]	16.2	0.7127
					Lus10033891 [exp]	17.6	0.6435
AT5G09970		CYP78A7	"cytochrome P450, family 78, s...		Lus10006821 [exp]	22.4	0.7111
AT5G43650	bHLH	BHLH92, bHLH092	basic helix-loop-helix (bHLH) ...		Lus10008804 [exp]	29.0	0.6554
AT1G64660		ATMGL	methionine gamma-lyase (.1)		Lus10000880 [exp]	31.2	0.6763

Compare expression of checked genes

Lus10015520 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.