Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30320 164 / 7e-52 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G57625 156 / 2e-48 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 153 / 3e-47 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 132 / 2e-39 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25780 131 / 9e-39 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G31470 125 / 2e-36 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14610 124 / 2e-36 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT4G33720 122 / 2e-35 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G09590 122 / 2e-35 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14580 119 / 3e-34 ATPRB1 basic pathogenesis-related protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019993 [exp] 274 / 2e-94 AT4G30320 197 / 7e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006980 [exp] 194 / 8e-64 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10001319 [exp] 194 / 1e-63 AT4G30320 201 / 6e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10013693 [exp] 129 / 5e-38 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10005557 [exp] 129 / 9e-38 AT4G31470 199 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006981 [exp] 125 / 2e-36 AT4G25780 235 / 2e-79 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10020491 [exp] 124 / 3e-36 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1) Lus10020493 [exp] 114 / 4e-32 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1) Lus10012479 [exp] 113 / 7e-32 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G096007 [exp] 177 / 5e-57 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G171300 [exp] 172 / 4e-55 AT4G30320 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G007000 [exp] 129 / 9e-38 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083600 [exp] 123 / 6e-36 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288600 [exp] 122 / 1e-35 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1) Potri.009G083100 [exp] 120 / 5e-35 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083300 [exp] 119 / 2e-34 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 115 / 9e-33 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096028 [exp] 114 / 2e-31 AT4G25780 219 / 3e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288301 [exp] 110 / 5e-31 AT2G14580 202 / 1e-67 basic pathogenesis-related protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10015522 pacid=23173647 polypeptide=Lus10015522 locus=Lus10015522.g ID=Lus10015522.BGIv1.0 annot-version=v1.0 ATGTACGCCATCTCCGGCCAGCGTCCACTCGCCACAGCCAAACTCATCATAATCCCACTCCTAATCCTTATCCTCTTCGACACCGCGACATTCGCTCGTG GAGCCACCACCTCCACAAAATTGCCGAAAAGCAGGGCATATGCTAGCGCAGTCGCGAAATTCATGGGACCGCAAAATGCTGCTAGAGCGGCATTGAAGCT GCCCCCACTGCGTTGGGATGAGAGACTGGCACGATACGCGACGTGGTATGCAAACCAGAGGAGGCTAGACTGTGCCATGGTGCACTCGAACGGTCCCTAC GGTGAGAATATATTCTGGGGGAGCGGAAATGGAGCAGGGTGGACTCCGGCTCATGCTGTTTCAGCGTGGGTTGGGGAGAGGAAGTCGTATAGCTATTGGT CCAACTCGTGTGGTGGAGGGAACGAGGGGTGTGGGCATTACACGCAGATCGTGTGGAGGAGGACTATTCGGGTTGGGTGTGCCCGGGTTGTTTGTAACGG TGGGAAGGGGGTGTTCATGAGTTGTAACTATGACCCGCCTGGGAACTACGTTGGGGAGAGGCCTTATTGA
AA sequence Show only first row Show all	>Lus10015522 pacid=23173647 polypeptide=Lus10015522 locus=Lus10015522.g ID=Lus10015522.BGIv1.0 annot-version=v1.0 MYAISGQRPLATAKLIIIPLLILILFDTATFARGATTSTKLPKSRAYASAVAKFMGPQNAARAALKLPPLRWDERLARYATWYANQRRLDCAMVHSNGPY GENIFWGSGNGAGWTPAHAVSAWVGERKSYSYWSNSCGGGNEGCGHYTQIVWRRTIRVGCARVVCNGGKGVFMSCNYDPPGNYVGERPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30320			CAP (Cysteine-rich secretory p...		Lus10015522 [exp]	0	1
AT4G39220		ATRER1A	Rer1 family protein (.1)		Lus10002890 [exp]	1.4	0.7898
AT5G20550			2-oxoglutarate (2OG) and Fe(II...		Lus10016145 [exp]	1.4	0.8801
					Lus10004305 [exp]	9.7	0.7161
AT3G25210			Tetratricopeptide repeat (TPR)...		Lus10038214 [exp]	12.4	0.6312
AT1G15460		ATBOR4	ARABIDOPSIS THALIANA REQUIRES ...		Lus10013116 [exp]	12.4	0.7348
AT1G62935			unknown protein		Lus10009297 [exp]	15.0	0.7858
AT1G21360		GLTP2	glycolipid transfer protein 2 ...		Lus10028618 [exp]	15.7	0.7775
AT1G68630			PLAC8 family protein (.1)		Lus10009036 [exp]	24.2	0.7653
					Lus10016409 [exp]	29.3	0.5840
AT4G31970		CYP82C2, JAH1	"cytochrome P450, family 82, s...		Lus10025923 [exp]	29.7	0.7811

Compare expression of checked genes

Lus10015522 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.