Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019995 [exp] 105 / 2e-27 AT2G20140 827 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1) Lus10000030 [exp] 67 / 5e-15 AT4G29040 276 / 5e-93 regulatory particle AAA-ATPase 2A (.1) Lus10006976 [exp] 68 / 2e-14 AT4G29040 828 / 0.0 regulatory particle AAA-ATPase 2A (.1) Lus10011901 [exp] 45 / 2e-06 AT2G20140 844 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1) Lus10022834 [exp] 42 / 4e-05 AT2G20140 735 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G194700 [exp] 41 / 4e-05 AT4G29040 829 / 0.0 regulatory particle AAA-ATPase 2A (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015523 pacid=23173648 polypeptide=Lus10015523 locus=Lus10015523.g ID=Lus10015523.BGIv1.0 annot-version=v1.0 ATGGGACAAGGTGCGTCAGGAATGAACCGGCCGCCGGGCGATAAGAAAGGCGACCCCGACAAGAAGGACAAGAAGTACGAGCCGGCCGCTCCCCCTACCC GCGTCGGCCGACAGCAGCGCTCCCCCTACCCGCGTCGGCCGAAAGCAGCGCAAGCAGAAGGGTTCCGAGACGGCTGCGAGGCTGCCTACTGTGACGCCGT TGACCAAGTGCAAGCTGCGCCTGTTGAAGATGGAGCGCATCAAGGATTACTTGCTGATGGAGGAGGAATTCGTCTCCAATCAGGAGCGGCTGAAGCCTCA GGAGGAGAAGAACGAGGAGGATCGATCCAAAGTCGATGA
AA sequence Show only first row Show all	>Lus10015523 pacid=23173648 polypeptide=Lus10015523 locus=Lus10015523.g ID=Lus10015523.BGIv1.0 annot-version=v1.0 MGQGASGMNRPPGDKKGDPDKKDKKYEPAAPPTRVGRQQRSPYPRRPKAAQAEGFRDGCEAAYCDAVDQVQAAPVEDGAHQGLLADGGGIRLQSGAAEAS GGEERGGSIQSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G29040		RPT2A	regulatory particle AAA-ATPase...		Lus10015523 [exp]	0	1
AT5G03280		CKR1, PIR2, ORE...	ORESARA 3, ORESARA 2, ENHANCED...		Lus10026517 [exp]	10.2	0.6070
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10025522 [exp]	22.5	0.6112
AT5G23490			unknown protein		Lus10004286 [exp]	55.6	0.6103
AT5G28823			unknown protein		Lus10040056 [exp]	56.6	0.5242
AT2G24230			Leucine-rich repeat protein ki...		Lus10035826 [exp]	58.5	0.5882
AT5G13530		KEG	KEEP ON GOING, protein kinases...		Lus10024136 [exp]	73.6	0.5966
AT1G77460			Armadillo/beta-catenin-like re...		Lus10042730 [exp]	90.6	0.5855
					Lus10033046 [exp]	174.3	0.5124

Compare expression of checked genes

Lus10015523 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.