Lus10015533 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020005 59 / 3e-11 AT5G57280 327 / 2e-113 root initiation defective 2, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10028960 45 / 2e-06 AT5G57280 444 / 4e-159 root initiation defective 2, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10007484 45 / 3e-06 AT5G57280 436 / 9e-156 root initiation defective 2, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10015533 pacid=23173654 polypeptide=Lus10015533 locus=Lus10015533.g ID=Lus10015533.BGIv1.0 annot-version=v1.0
ATGGGTTTGTATCGTCATCTCACCGAGGTTCGAGCAAATCCGATAGAATACAAAGGCTTGCCATTTAGGCCTGGAACTATTGATGGTGCCATTAGTATCT
CTGCTGTTCAGTACCAAGAGCAGAAAGGAGTACTTGGTTCTCACTTGCGGACCAGCATCAATCGATACAGCTGTCCCAGACCAAAAGGTCTAGACGGCGA
CGAAAGCTGCTCTGAGGATGAAAGCGGTGATTACTATGATGAAGAAAAGCAAACAGTTAGCATGTCAGATAGACACAGACCAAAGGAAAGGCAAAAACAG
GGAAGAAAGGGAAAGGGAAGCAATGATATTGAAGAAGGAGCAGATGAGGGGTAA
AA sequence
>Lus10015533 pacid=23173654 polypeptide=Lus10015533 locus=Lus10015533.g ID=Lus10015533.BGIv1.0 annot-version=v1.0
MGLYRHLTEVRANPIEYKGLPFRPGTIDGAISISAVQYQEQKGVLGSHLRTSINRYSCPRPKGLDGDESCSEDESGDYYDEEKQTVSMSDRHRPKERQKQ
GRKGKGSNDIEEGADEG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G57280 RID2 root initiation defective 2, S... Lus10015533 0 1
AT4G04750 Major facilitator superfamily ... Lus10018957 1.0 0.9217
AT5G03455 ACR2, ARATH;CDC... ARSENATE REDUCTASE 2, Rhodanes... Lus10014420 1.4 0.9104
AT1G62300 WRKY ATWRKY6, WRKY6 WRKY family transcription fact... Lus10021554 3.5 0.8674
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10029184 3.5 0.8844
AT4G10120 ATSPS4F Sucrose-phosphate synthase fam... Lus10006183 7.3 0.8049
AT5G51490 Plant invertase/pectin methyle... Lus10027203 7.7 0.8120
AT3G04070 NAC ANAC047 NAC domain containing protein ... Lus10021992 7.9 0.8454
Lus10039365 8.8 0.7939
AT1G69490 NAC NAP, ANAC029, A... Arabidopsis NAC domain contain... Lus10026617 10.1 0.8183
Lus10006216 12.2 0.8375

Lus10015533 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.