Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62040 231 / 6e-80 ATG8C autophagy 8c, Ubiquitin-like superfamily protein (.1.2) AT2G05630 216 / 2e-74 ATG8D Ubiquitin-like superfamily protein (.1.2) AT4G21980 216 / 3e-74 ATG8A, APG8A AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2) AT4G04620 210 / 7e-72 ATG8B autophagy 8b, Ubiquitin-like superfamily protein (.1.2) AT4G16520 205 / 5e-70 ATG8F autophagy 8f, Ubiquitin-like superfamily protein (.1.2) AT3G60640 197 / 8e-67 ATG8G AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1) AT2G45170 194 / 2e-65 ATATG8E AUTOPHAGY 8E (.1.2) AT3G15580 139 / 6e-44 APG8H, ATG8I AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1) AT3G06420 133 / 2e-41 ATG8H autophagy 8h, Ubiquitin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027186 [exp] 225 / 8e-78 AT2G05630 222 / 1e-76 Ubiquitin-like superfamily protein (.1.2) Lus10008507 [exp] 205 / 8e-70 AT4G16520 216 / 3e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10000733 [exp] 204 / 2e-69 AT4G16520 217 / 1e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10028933 [exp] 201 / 3e-68 AT4G16520 215 / 6e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10039656 [exp] 202 / 1e-67 AT2G05630 203 / 6e-68 Ubiquitin-like superfamily protein (.1.2) Lus10004352 [exp] 193 / 6e-65 AT2G45170 203 / 1e-68 AUTOPHAGY 8E (.1.2) Lus10038046 [exp] 136 / 1e-42 AT3G15580 199 / 1e-67 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1) Lus10009987 [exp] 129 / 1e-35 AT3G62240 625 / 0.0 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G153800 [exp] 227 / 1e-78 AT2G05630 202 / 6e-69 Ubiquitin-like superfamily protein (.1.2) Potri.002G228800 [exp] 227 / 1e-78 AT2G05630 224 / 1e-77 Ubiquitin-like superfamily protein (.1.2) Potri.011G004300 [exp] 221 / 7e-76 AT4G21980 219 / 1e-74 AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2) Potri.004G013700 [exp] 219 / 2e-75 AT1G62040 216 / 3e-74 autophagy 8c, Ubiquitin-like superfamily protein (.1.2) Potri.002G144600 [exp] 213 / 3e-73 AT3G60640 192 / 8e-65 AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1) Potri.003G110901 [exp] 209 / 2e-71 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.008G136040 [exp] 209 / 2e-71 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.001G122700 [exp] 208 / 3e-71 AT4G16520 191 / 2e-64 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.014G060300 [exp] 201 / 2e-68 AT4G16520 214 / 1e-73 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.008G099400 [exp] 140 / 3e-44 AT3G15580 187 / 7e-63 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02991 [flax] [poplar] Atg8 Autophagy protein Atg8 ubiquitin like
Representative CDS sequence Show only first row Show all	>Lus10015563 pacid=23173657 polypeptide=Lus10015563 locus=Lus10015563.g ID=Lus10015563.BGIv1.0 annot-version=v1.0 ATGGCCAAAAGTTCCTTCAAGCTCGAACACCCTCTCGAGAGGCGCCAAGCTGAGGCTTCTCGTATCAGGGAGAAGTATCCTGATAGAATTCCTGTCATTG TGGAAAAGGCTGAGAGGAGTGATGTTCCTGACATTGATAAGAAGAAGTACCTTGTCCCGGCAGATTTAACTGTGGGGCAGTTTGTCTATGTTGTCCGGAA AAGGATCAAACTCAGCGCTGAAAAGGCCATATTCGTCTTTGTCAAGAACACATTGCCACCAACAGCTGCAATGTTGTCTGCTATATACGAGGAGAACAAG GATGAAGATGGCTTTCTTTACATGACCTACAGTGGGGAGAACACCTTTGGATGCTCCCAGTAG
AA sequence Show only first row Show all	>Lus10015563 pacid=23173657 polypeptide=Lus10015563 locus=Lus10015563.g ID=Lus10015563.BGIv1.0 annot-version=v1.0 MAKSSFKLEHPLERRQAEASRIREKYPDRIPVIVEKAERSDVPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFVFVKNTLPPTAAMLSAIYEENK DEDGFLYMTYSGENTFGCSQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G62040		ATG8C	autophagy 8c, Ubiquitin-like s...		Lus10015563 [exp]	0	1
AT1G44770			unknown protein		Lus10014131 [exp]	1.0	0.9823
AT1G04970			lipid-binding serum glycoprote...		Lus10014625 [exp]	1.4	0.9747
AT5G64370		PYD3, BETA-UP	PYRIMIDINE 3, beta-ureidopropi...		Lus10020436 [exp]	1.7	0.9672
AT5G39510		ZIG1, SGR4, ATV...	SHOOT GRAVITROPSIM 4, VESICLE ...		Lus10034696 [exp]	2.0	0.9668
AT2G16385			unknown protein		Lus10017979 [exp]	3.0	0.9558
AT4G22310			Uncharacterised protein family...		Lus10023745 [exp]	3.9	0.9651
AT2G25950			Protein of unknown function (D...		Lus10007454 [exp]	4.0	0.9565
AT1G72680		ATCAD1	CINNAMYL ALCOHOL DEHYDROGENASE...		Lus10010149 [exp]	4.9	0.9491
AT3G26100			Regulator of chromosome conden...		Lus10006242 [exp]	5.3	0.9593
AT5G58220		ALNS, TTL	allantoin synthase, transthyre...		Lus10035966 [exp]	6.2	0.9514

Compare expression of checked genes

Lus10015563 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.