Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015565 pacid=23145887 polypeptide=Lus10015565 locus=Lus10015565.g ID=Lus10015565.BGIv1.0 annot-version=v1.0 ATGGCGGTGTCGCGTGCGGTGTACATTATGACGGTGCCGGCCGCTACCGCTGCCTTGGGATGTTACCTGCTTGATAGAACGTCCTCTTCGGTGATCCACA CCCATCCCTTCCAATCTTCTCCTCTGAGTTTGGGTGAATGTAGCAAGGACAGCGAGAGCTGTAGACGGATTCCGCCGACGGCAGCGGCGGCTGCAGGAAC AGCTGAGAAAAATCAAACGGCAAATTTAGCTCCTCAGTTGGATGGGTTATTCTGTTTTGAGACCTTGGTGGCTGGTTTTCCATGA
AA sequence Show only first row Show all	>Lus10015565 pacid=23145887 polypeptide=Lus10015565 locus=Lus10015565.g ID=Lus10015565.BGIv1.0 annot-version=v1.0 MAVSRAVYIMTVPAATAALGCYLLDRTSSSVIHTHPFQSSPLSLGECSKDSESCRRIPPTAAAAAGTAEKNQTANLAPQLDGLFCFETLVAGFP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10015565 [exp]	0	1
AT1G60360			RING/U-box superfamily protein...		Lus10025612 [exp]	4.1	0.9322
AT4G16640			Matrixin family protein (.1)		Lus10004728 [exp]	7.9	0.9113
AT2G02130		PDF2.3, LCR68	low-molecular-weight cysteine-...		Lus10004289 [exp]	7.9	0.9067
AT1G63310			unknown protein		Lus10008287 [exp]	8.1	0.9209
AT1G63310			unknown protein		Lus10033253 [exp]	8.7	0.9208
AT1G14730			Cytochrome b561/ferric reducta...		Lus10031935 [exp]	10.0	0.9194
AT3G48310		CYP71A22	"cytochrome P450, family 71, s...		Lus10029787 [exp]	11.0	0.9032
					Lus10015603 [exp]	12.0	0.8899
AT3G20570		AtENODL9	early nodulin-like protein 9 (...		Lus10011158 [exp]	14.5	0.9155
AT2G29630		PY, THIC	PYRIMIDINE REQUIRING, thiaminC...		Lus10040694 [exp]	15.0	0.8879

Compare expression of checked genes

Lus10015565 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.